Skip to content

dna

/dˈiˌɛnˈeɪ/noun3 syllables

Dna means: (biochemistry) a long linear polymer found in the nucleus of a cell and formed from nucleotides and shaped like a double helix; associated with the transmission of genetic information.

Synonyms for dna2

noun, as in (biochemistry) a long linear polymer found in the nucleus of a cell and formed from nucleotides and shaped like a double helix; associated with the transmission of genetic information

deoxyribonucleic acid, desoxyribonucleic acid

What does dna mean?1

noun

1

(biochemistry) a long linear polymer found in the nucleus of a cell and formed from nucleotides and shaped like a double helix; associated with the transmission of genetic information“DNA is the king of molecules”

Definitions from the Open English WordNet, CC BY 4.0.

What rhymes with dna?60

three syllables

usaeveryday
Show 40 near rhymes
makemadetakegreatsamestategameplacedaysnamecasechangestatesbasedcamemakesfacegameswaitlateagegavemainplayedspacedatebreaktakesbecameratesavepagepaidrangetradehatejamesstageracechanged

All 60 rhymes for dna, grouped by syllable

Dna in a sentence

  • DNA is composed of four nucleotides: adenine, thymine, cytosine and guanine.Hybrid
  • DNA is a complex chemical that makes up a gene.unknown
  • DNA is known for its double helix shape.shekitten
  • It shouldn't be permitted to store samples of DNA.Lumi_alt
  • Genes consist of a specific sequence of DNA.Source_VOA
  • Everything you knew about DNA is not going to help you through this course.marcelostockle
  • Scientists worked to reconstitute the ancient DNA extracted from the fossil.rul
  • The DNA test cleared him of all charges.darinmex

Sentences from Tatoeba, CC BY 2.0 FR, credited to their authors.

Forms of dna

as a noun

plural
dnas