Skip to content

ip

/ˈaɪpˈi/noun2 syllables

Ip means: the sciences concerned with gathering, manipulating, storing, retrieving, and classifying recorded information.

Synonyms for ip3

noun, as in the sciences concerned with gathering, manipulating, storing, retrieving, and classifying recorded information

information science, informatics, information processing

What does ip mean?1

noun

1

the sciences concerned with gathering, manipulating, storing, retrieving, and classifying recorded information

Definitions from the Open English WordNet, CC BY 4.0.

What rhymes with ip?60

three syllables

guarantee
Show 40 near rhymes
thesehereneedbetweeneachfeelteamkeeppleaserealweekmeanseenbelieveleastmeansneedsleavepolicedealstreetmeetfieldseemshearweekseastreceivedeatgreenleaguechiefcompletereleaseincreaseseemdeepreleasedsleeppiece

All 60 rhymes for ip, grouped by syllable

Ip in a sentence

  • Keyboard warriors are dying now that their IP addresses have been made public.Cabo
  • The browser queries the DNS server to find out the IP address.EugeneGS
  • You can study IP related material during work hours when you have time to spare.unknown
  • PIPA is an acronym for the PROTECT IP Act.Spamster
  • An ICANN domain signifies an IP address to a DNS server.gleki
  • I use an anonymous IP address.Pineapple

Sentences from Tatoeba, CC BY 2.0 FR, credited to their authors.