5-Letter Words Starting With FL
76 five-letter words start with FL, including floor, flash, flood, fleet. Useful when your Wordle guess has locked the first two letters.
Highest scoring
- flaxy18
- flyby16
- flaky15
- fluky15
- flack14
- flawy14
- fleck14
- flick14
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list76
flabsflackflagsflailflairflakeflakyflameflamsflamyflankflansflapsflareflashflaskflatsflawsflawyflaxyflaysfleamfleasfleckfleerfleesfleetfleshflewsfleysflickflicsfliedflierfliesflingflintflipsflirtfliteflitsfloatflockflocsfloesflogsflongfloodfloorflopsfloraflossflotaflourfloutflownflowsflubsfluedfluesflufffluidflukeflukyflumeflumpflungflunkfluorflushfluteflutyfluytflybyflyerflyte