5-Letter Words Starting With L
401 5-letter words start with the letter L, including later, least, local, level. Every word below is valid in Scrabble-style word games.
Highest scoring
- lezzy26
- laxly15
- lazed15
- lymph15
- lazar14
- lazes14
- lucky14
- loxed13
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list401
laarilabellabialaborlabralacedlacerlaceslaceylacksladedladenladerladesladlelaevolaganlagerlaharlaichlaicslaighlairdlairslaithlaitylakedlakerlakeslakhslallslamaslambslambylamedlamerlameslamialampslanailancelandslaneslankylapellapinlapislapselarchlardslardylareelareslargelargolarislarkslarkylarumlarvalasedlaserlaseslassolastslatchlatedlatenlaterlatexlathelathilathslathylatkelattelauanlaudslaughlauralavaslavedlaverlaveslawedlawnslawnylaxerlaxlylayedlayerlayuplazarlazedlazesleachleadsleadyleafsleafyleaksleakyleansleantleapsleaptlearnlearslearyleaseleashleastleaveleavylebenledgeledgyleechleeksleersleeryleetsleftsleftylegallegerlegesleggylegitlehrslehualemanlemmalemonlemurlendsleneslenislenoslenselentoleoneleperleptaletchletheletupleudsleveelevelleverlevinlewislexeslexislezzylianalianeliangliardliarslibelliberlibralibrilichilichtlicitlickslidarlidosliegelienslierslieuslieveliferliftsliganligerlightlikedlikenlikerlikeslilacliltslimanlimaslimbalimbilimbolimbslimbylimedlimenlimeslimeylimitlimnslimoslimpalimpslinaclindylinedlinenlinerlineslineylingalingolingslingylininlinkslinkylinnslinoslintslintylinumlionslipidlipinlippyliraslirotlislelispslistslitailitasliterlithelitholitrelivedlivenliverliveslividlivrellamallanoloachloadsloafsloamsloamyloansloathlobarlobbylobedlobesloboslocallochslockslocoslocumlocuslodenlodeslodgeloessloftsloftyloganlogesloggylogialogiclogoilogosloinslollslollylonerlongelongsloobylooedlooeyloofaloofslooielooksloomsloonsloonyloopsloopylooselootslopedloperlopesloppyloralloranlordsloreslorislorryloselloserloseslossylotahlotasloticlotoslottelottolotusloughlouielouisloupeloupslourslourylouselousyloutslovatlovedloverloveslowedlowerloweslowlylowseloxedloxesloyalluauslubesluceslucidlucksluckylucreludesludicluffaluffslugedlugerlugeslullsluluslumenlumpslumpylunarlunaslunchluneslunetlungelungilungslunksluntslupinlupuslurchluredlurerluresluridlurkslustslustylususlutealutedlutesluxeslweislyardlyartlyaselycealyceelyinglymphlynchlyreslyriclysedlyseslysinlysislyssalyticlytta