Skip to content

Word lists

5-Letter Words Starting With PA

119 five-letter words start with PA, including party, paper, parts, paris. Useful when your Wordle guess has locked the first two letters.

Highest scoring

  • pawky17
  • pappy14
  • paxes14
  • packs13
  • pacha12
  • paddy12
  • palmy12
  • papaw12

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list119

pacaspacedpacerpacespachapackspactspaddypadispadlepadrepadripaeanpaeonpaganpagedpagerpagespagodpaikspailspainspaintpairspaisapaisepaleapaledpalerpalespaletpallspallypalmspalmypalpipalpspalsypampapandapandypanedpanelpanespangapangspanicpannepansypantopantspantypapalpapaspapawpaperpappipappyparasparchpardipardspardyparedpareoparerparespareupargepargoparisparkaparksparleparolparrsparryparsepartspartyparveparvopaseopasespashapassepastapastepastspastypatchpatedpatenpaterpatespathspatinpatiopatlypatsypattypausepavanpavedpaverpavespavidpavinpavispawedpawerpawkypawlspawnspaxespayedpayeepayerpayor