5-Letter Words Starting With SW

53 five-letter words start with SW, including sweet, swear, sword, swing. Useful when your Wordle guess has locked the first two letters.

Highest scoring

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

swabsswageswagsswailswainswaleswamiswampswamyswangswankswans swapsswardswareswarfswarmswartswashswathswats sways swear sweatswedesweepsweersweet swell swept swiftswigsswillswims swine swingswinkswipeswirlswishswissswithswiveswobsswoonswoopswopssword swore swornswotsswounswung