Skip to content

Word lists

5-Letter Words With H as the Second Letter

380 five-letter words have H as the second letter, including their, there, which, think. Perfect for narrowing down a Wordle guess with a yellow or green H.

Highest scoring

  • whizz29
  • ghazi18
  • choky17
  • khaph17
  • phlox17
  • whack17
  • whiff17
  • chaff16

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list380

aheadaholdahullbhangbhootbhutschadschafechaffchainchairchalkchampchamschangchantchaoschapechapschaptchardcharecharkcharmcharrcharschartcharychasechasmchatschawschayscheapcheatcheckcheekcheepcheerchefschelachemochertchesschestchethchevychewschewychiaochiaschickchicochicschidechiefchielchildchilechilichillchimbchimechimpchinachinechinkchinochinschipschirkchirmchirochirpchirrchitschivechivychockchoirchokechokycholochompchookchopschordchorechosechottchowschubschuckchufachuffchugschumpchumschunkchurlchurnchurrchutechylechymedhaksdhalsdhobidholedhotidhowsdhutighastghatsghautghazigheesghostghoulghyllihramkhadikhafskhakikhanskhaphkhatskhedakhethkhetskhoumohiasohingohmicphagephasephialphloxphonephonophonsphonyphotophotsphphtphutsphylaphylerheasrheumrhinorhombrhumbrhymerhytashackshadeshadsshadyshaftshagsshahsshakeshakoshakyshaleshallshaltshalyshameshamsshankshapeshardsharesharksharnsharpshaulshaveshawlshawmshawnshawsshayssheafshealshearsheasshedssheensheepsheersheetsheikshelfshellshendshentsheolsherdshewnshewsshiedshielshiershiesshiftshillshilyshimsshineshinsshinyshipsshireshirkshirrshirtshistshitsshivashiveshivsshlepshoalshoatshockshoedshoershoesshogsshojishoneshookshoolshoonshoosshootshopsshoreshorlshornshortshoteshotsshottshoutshoveshownshowsshowyshoyushredshrewshrisshrubshrugshtikshuckshulnshulsshunsshuntshushshuteshutsshyershylythackthanethanktharmthawsthebethecatheftthegntheintheirthemethenstherethermthesethetathewsthewythickthiefthighthillthinethingthinkthinsthiolthirdthirltholethongthornthorothorpthosethousthrawthreethrewthripthrobthroethrowthrumthudsthugsthujathumbthumpthunkthurlthuyathymethymithymyuhlanwhackwhalewhamowhamswhangwhapswharfwhatswhaupwhealwheatwheelwheenwheepwhelkwhelmwhelpwhenswherewhetswhewswheyswhichwhidswhiffwhigswhilewhimswhinewhinswhinywhipswhiptwhirlwhirrwhirswhishwhiskwhistwhitewhitswhitywhizzwholewhompwhoofwhoopwhopswhorewhorlwhortwhosewhosowhump