5-Letter Words With H as the Second Letter
380 five-letter words have H as the second letter, including their, there, which, think. Perfect for narrowing down a Wordle guess with a yellow or green H.
Highest scoring
- whizz29
- ghazi18
- choky17
- khaph17
- phlox17
- whack17
- whiff17
- chaff16
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list380
aheadaholdahullbhangbhootbhutschadschafechaffchainchairchalkchampchamschangchantchaoschapechapschaptchardcharecharkcharmcharrcharschartcharychasechasmchatschawschayscheapcheatcheckcheekcheepcheerchefschelachemochertchesschestchethchevychewschewychiaochiaschickchicochicschidechiefchielchildchilechilichillchimbchimechimpchinachinechinkchinochinschipschirkchirmchirochirpchirrchitschivechivychockchoirchokechokycholochompchookchopschordchorechosechottchowschubschuckchufachuffchugschumpchumschunkchurlchurnchurrchutechylechymedhaksdhalsdhobidholedhotidhowsdhutighastghatsghautghazigheesghostghoulghyllihramkhadikhafskhakikhanskhaphkhatskhedakhethkhetskhoumohiasohingohmicphagephasephialphloxphonephonophonsphonyphotophotsphphtphutsphylaphylerheasrheumrhinorhombrhumbrhymerhytashackshadeshadsshadyshaftshagsshahsshakeshakoshakyshaleshallshaltshalyshameshamsshankshapeshardsharesharksharnsharpshaulshaveshawlshawmshawnshawsshayssheafshealshearsheasshedssheensheepsheersheetsheikshelfshellshendshentsheolsherdshewnshewsshiedshielshiershiesshiftshillshilyshimsshineshinsshinyshipsshireshirkshirrshirtshistshitsshivashiveshivsshlepshoalshoatshockshoedshoershoesshogsshojishoneshookshoolshoonshoosshootshopsshoreshorlshornshortshoteshotsshottshoutshoveshownshowsshowyshoyushredshrewshrisshrubshrugshtikshuckshulnshulsshunsshuntshushshuteshutsshyershylythackthanethanktharmthawsthebethecatheftthegntheintheirthemethenstherethermthesethetathewsthewythickthiefthighthillthinethingthinkthinsthiolthirdthirltholethongthornthorothorpthosethousthrawthreethrewthripthrobthroethrowthrumthudsthugsthujathumbthumpthunkthurlthuyathymethymithymyuhlanwhackwhalewhamowhamswhangwhapswharfwhatswhaupwhealwheatwheelwheenwheepwhelkwhelmwhelpwhenswherewhetswhewswheyswhichwhidswhiffwhigswhilewhimswhinewhinswhinywhipswhiptwhirlwhirrwhirswhishwhiskwhistwhitewhitswhitywhizzwholewhompwhoofwhoopwhopswhorewhorlwhortwhosewhosowhump