5-Letter Words With L as the Second Letter
509 five-letter words have L as the second letter, including place, black, along, class. Perfect for narrowing down a Wordle guess with a yellow or green L.
Highest scoring
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list509
alackalamoalandalanealangalansalantalarmalaryalatealbasalbumalcidalderaldolalecsalefsalephalertalfasalgaealgalalgasalgidalginalgoralgumaliasalibialienalifsalignalikealinealistalivealiyaalkydalkylallayalleealleyallodallotallowalloyallylalmahalmasalmehalmesalmudalmugaloesaloftalohaaloinalonealongaloofaloudalphaaltaralteralthoaltosalulaalumsalwayblabsblackbladeblahsblainblameblamsblandblankblareblaseblastblateblatsblawnblawsblazebleakblearbleatblebsbleedbleepblendblentblessblestbletsblimpblimyblindbliniblinkblipsblissbliteblitzbloatblobsblockblocsblokeblondbloodbloombloopblotsblownblowsblowyblubsbluedbluerbluesbluetblueybluffblumebluntblurbblursblurtblushblypeclachclackcladecladsclagsclaimclampclamsclangclankclansclapsclaptclaroclaryclashclaspclassclastclaveclaviclawsclayscleanclearcleatcleekclefscleftclepecleptclerkclewsclickcliffcliftclimbclimeclineclingclinkclipscliptcloakclockclodsclogsclombclompcloneclonkclonsclootclopscloseclothclotscloudclourcloutcloveclowncloysclozeclubscluckcluedcluesclumpclungclunkelainelandelanselateelbowelderelectelegyelemielfinelideelinteliteeloinelopeeludeeluteelverelvesflabsflackflagsflailflairflakeflakyflameflamsflamyflankflansflapsflareflashflaskflatsflawsflawyflaxyflaysfleamfleasfleckfleerfleesfleetfleshflewsfleysflickflicsfliedflierfliesflingflintflipsflirtfliteflitsfloatflockflocsfloesflogsflongfloodfloorflopsfloraflossflotaflourfloutflownflowsflubsfluedfluesflufffluidflukeflukyflumeflumpflungflunkfluorflushfluteflutyfluytflybyflyerflyteglacegladegladsgladyglairglandglansglareglaryglassglazeglazygleamgleanglebaglebegledegledsgleedgleekgleesgleetglensgleysglialgliasglidegliffglimeglimsglintglitzgloamgloatglobeglobsgloggglomsgloomglopsgloryglossglostgloutgloveglowsglozegluedgluergluesglueyglugsglumegluonglutsglyphileacilealileumileusiliaciliadilialiliumillerklongkloofklugeklutzllamallanooldenolderoldieoleicoleinoleosoleumoliosoliveollasologyplaceplackplageplaidplainplaitplaneplankplansplantplashplasmplateplatsplatyplayaplaysplazapleadpleaspleatplebeplebsplenaplewsplicapliedplierpliesplinkplodsplonkplopsplotsplotzplowsployspluckplugsplumbplumeplumpplumsplumyplunkplushplyerslabsslackslagsslainslakeslamsslangslankslantslapsslashslateslatsslatyslaveslawsslayssledssleeksleepsleetsleptslewssliceslickslideslierslilyslimeslimsslimyslingslinkslipeslipssliptslitsslobssloesslogssloidslojdsloopslopeslopssloshslothslotsslowssloydslubssluedsluessluffslugsslumpslumsslungslunkslurbslurpslursslushslutsslyerslylyslypeulamaulansulcerulemaulnadulnaeulnarulnasulpanultraulvasylemszlotezloty