Skip to content

Word lists

5-Letter Words With L as the Second Letter

509 five-letter words have L as the second letter, including place, black, along, class. Perfect for narrowing down a Wordle guess with a yellow or green L.

Highest scoring

  • flaxy18
  • glazy18
  • klutz18
  • zloty17
  • blaze16
  • blitz16
  • cloze16
  • flyby16

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list509

alackalamoalandalanealangalansalantalarmalaryalatealbasalbumalcidalderaldolalecsalefsalephalertalfasalgaealgalalgasalgidalginalgoralgumaliasalibialienalifsalignalikealinealistalivealiyaalkydalkylallayalleealleyallodallotallowalloyallylalmahalmasalmehalmesalmudalmugaloesaloftalohaaloinalonealongaloofaloudalphaaltaralteralthoaltosalulaalumsalwayblabsblackbladeblahsblainblameblamsblandblankblareblaseblastblateblatsblawnblawsblazebleakblearbleatblebsbleedbleepblendblentblessblestbletsblimpblimyblindbliniblinkblipsblissbliteblitzbloatblobsblockblocsblokeblondbloodbloombloopblotsblownblowsblowyblubsbluedbluerbluesbluetblueybluffblumebluntblurbblursblurtblushblypeclachclackcladecladsclagsclaimclampclamsclangclankclansclapsclaptclaroclaryclashclaspclassclastclaveclaviclawsclayscleanclearcleatcleekclefscleftclepecleptclerkclewsclickcliffcliftclimbclimeclineclingclinkclipscliptcloakclockclodsclogsclombclompcloneclonkclonsclootclopscloseclothclotscloudclourcloutcloveclowncloysclozeclubscluckcluedcluesclumpclungclunkelainelandelanselateelbowelderelectelegyelemielfinelideelinteliteeloinelopeeludeeluteelverelvesflabsflackflagsflailflairflakeflakyflameflamsflamyflankflansflapsflareflashflaskflatsflawsflawyflaxyflaysfleamfleasfleckfleerfleesfleetfleshflewsfleysflickflicsfliedflierfliesflingflintflipsflirtfliteflitsfloatflockflocsfloesflogsflongfloodfloorflopsfloraflossflotaflourfloutflownflowsflubsfluedfluesflufffluidflukeflukyflumeflumpflungflunkfluorflushfluteflutyfluytflybyflyerflyteglacegladegladsgladyglairglandglansglareglaryglassglazeglazygleamgleanglebaglebegledegledsgleedgleekgleesgleetglensgleysglialgliasglidegliffglimeglimsglintglitzgloamgloatglobeglobsgloggglomsgloomglopsgloryglossglostgloutgloveglowsglozegluedgluergluesglueyglugsglumegluonglutsglyphileacilealileumileusiliaciliadilialiliumillerklongkloofklugeklutzllamallanooldenolderoldieoleicoleinoleosoleumoliosoliveollasologyplaceplackplageplaidplainplaitplaneplankplansplantplashplasmplateplatsplatyplayaplaysplazapleadpleaspleatplebeplebsplenaplewsplicapliedplierpliesplinkplodsplonkplopsplotsplotzplowsployspluckplugsplumbplumeplumpplumsplumyplunkplushplyerslabsslackslagsslainslakeslamsslangslankslantslapsslashslateslatsslatyslaveslawsslayssledssleeksleepsleetsleptslewssliceslickslideslierslilyslimeslimsslimyslingslinkslipeslipssliptslitsslobssloesslogssloidslojdsloopslopeslopssloshslothslotsslowssloydslubssluedsluessluffslugsslumpslumsslungslunkslurbslurpslursslushslutsslyerslylyslypeulamaulansulcerulemaulnadulnaeulnarulnasulpanultraulvasylemszlotezloty