Skip to content

Word lists

5-Letter Words With P as the Fourth Letter

273 five-letter words have P as the fourth letter, including happy, helps, steps, shape. Perfect for narrowing down a Wordle guess with a yellow or green P.

Highest scoring

  • zappy21
  • zippy21
  • jimpy19
  • jumpy19
  • khaph17
  • jumps16
  • quips16
  • quipu16

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list273

adaptadeptadoptagapealephatapsatopybeepsblipsblypebumphbumpsbumpyburpscampicampocampscampycarpicarpschapechapschaptchipschopsclapsclaptclepecleptclipscliptclopscoaptcompocompscomptcoopscooptcorpscoupecoupscoypucrapecrapscrepecreptcrepycripecropscryptculpacuppacuppycuspsdampsdeepsdippydorpsdrapedripsdriptdropsdroptdrupedumpsdumpyelopeeruptetapeflapsflipsflopsfrapsgampsgappygaspsgawpsgimpsgimpyglopsglyphgoopsgoopygorpsgrapegraphgrapygripegripsgriptgripygropegulpsgulpyguppyhappyharpsharpyhaspsheapshelpshempshempyhippohippyhoopshoppyhumphhumpshumpyinaptineptjaupsjeepsjimpyjumpsjumpykalpakappakeepskelpskelpykempskemptkhaphknapsknopskoppalampsleapsleaptlimpalimpslippylispsloopsloopyloppyloupeloupslumpslumpylymphmilpamorphmumpsmyopemyopynappenappyneapsneepsnippynymphokapioomphpalpipalpspampapappipappypeepspeppypimpsplopspompspoopspoppapoppyprepspropspulpspulpypumpspuppyquipsquipuralphrampsraspsraspyreapsreppsrompsroupsroupyrumpssalpasalpssampssappyscapescopescopsscupsseepsseepyshapeshipsshopssimpsskepsskipsslapssleptslipeslipssliptslopeslopsslypesnapssnipesnipssoapssoapysoppysoupssoupystaphstepsstipestopestopsstoptstupastupesumpsswapssweptswipeswopssylphtampstarpstaupetempitempotempstempttippytrapstrapttripetripstropetumpsturpstyppsunaptvampsveepswarpswaspswaspyweepsweepywhapswhipswhiptwhopswimpswimpywispswispywoopswrapswraptyaupsyawpsyelpszappyzippy