5-Letter Words With P as the Fourth Letter
273 five-letter words have P as the fourth letter, including happy, helps, steps, shape. Perfect for narrowing down a Wordle guess with a yellow or green P.
Highest scoring
- zappy21
- zippy21
- jimpy19
- jumpy19
- khaph17
- jumps16
- quips16
- quipu16
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list273
adaptadeptadoptagapealephatapsatopybeepsblipsblypebumphbumpsbumpyburpscampicampocampscampycarpicarpschapechapschaptchipschopsclapsclaptclepecleptclipscliptclopscoaptcompocompscomptcoopscooptcorpscoupecoupscoypucrapecrapscrepecreptcrepycripecropscryptculpacuppacuppycuspsdampsdeepsdippydorpsdrapedripsdriptdropsdroptdrupedumpsdumpyelopeeruptetapeflapsflipsflopsfrapsgampsgappygaspsgawpsgimpsgimpyglopsglyphgoopsgoopygorpsgrapegraphgrapygripegripsgriptgripygropegulpsgulpyguppyhappyharpsharpyhaspsheapshelpshempshempyhippohippyhoopshoppyhumphhumpshumpyinaptineptjaupsjeepsjimpyjumpsjumpykalpakappakeepskelpskelpykempskemptkhaphknapsknopskoppalampsleapsleaptlimpalimpslippylispsloopsloopyloppyloupeloupslumpslumpylymphmilpamorphmumpsmyopemyopynappenappyneapsneepsnippynymphokapioomphpalpipalpspampapappipappypeepspeppypimpsplopspompspoopspoppapoppyprepspropspulpspulpypumpspuppyquipsquipuralphrampsraspsraspyreapsreppsrompsroupsroupyrumpssalpasalpssampssappyscapescopescopsscupsseepsseepyshapeshipsshopssimpsskepsskipsslapssleptslipeslipssliptslopeslopsslypesnapssnipesnipssoapssoapysoppysoupssoupystaphstepsstipestopestopsstoptstupastupesumpsswapssweptswipeswopssylphtampstarpstaupetempitempotempstempttippytrapstrapttripetripstropetumpsturpstyppsunaptvampsveepswarpswaspswaspyweepsweepywhapswhipswhiptwhopswimpswimpywispswispywoopswrapswraptyaupsyawpsyelpszappyzippy