Skip to content

Word lists

5-Letter Words With R as the Second Letter

645 five-letter words have R as the second letter, including great, group, order, wrong. Perfect for narrowing down a Wordle guess with a yellow or green R.

Highest scoring

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list645

araksarborarcedarcusardebardorareaearealareasarecaareicarenaareteargalargilargleargolargonargotargueargusarhatariasarielarilsarisearlesarmedarmerarmetarmoraroidaromaarosearpenarrasarrayarrisarrowarsesarsisarsonartalartelartsyarumsarvalarvosarylsbracebrachbractbradsbraesbragsbraidbrailbrainbrakebrakybrandbrankbransbrantbrashbrassbratsbravabravebravibravobrawlbrawnbrawsbraxybraysbrazabrazebreadbreakbreambredebreedbreesbrensbrentbrevebrewsbriarbribebrickbridebriefbrierbriesbrigsbrillbrimsbrinebringbrinkbrinsbrinybriosbriskbritsbrittbroadbrockbroilbrokebromebromobroncbroodbrookbroombroosbrosebrosybrothbrownbrowsbrughbruinbruitbrumebruntbrushbruskbrutecraalcrabscrackcraftcragscrakecrampcramscranecrankcrapecrapscrashcrasscratecravecrawlcrawscrazecrazycreakcreamcredocreedcreekcreelcreepcremecrepecreptcrepycresscrestcrewscribscrickcriedcriercriescrimecrimpcripecrispcroakcrocicrockcrocscroftcronecronycrookcrooncropscrorecrosscroupcrowdcrowncrowscrozecruckcrudecrudscruelcruetcrumbcrumpcruorcruracrusecrushcrustcrwthcryptdrabsdraffdraftdragsdraildraindrakedramadramsdrankdrapedratsdravedrawldrawndrawsdraysdreaddreamdreardreckdreeddreesdregsdreksdressdrestdribsdrieddrierdriesdriftdrilldrilydrinkdripsdriptdrivedroitdrolldronedrooldroopdropsdroptdrossdroukdrovedrowndrubsdrugsdruiddrumsdrunkdrupedrusedryaddryerdrylyeraseerectergotericaerneserodeeroseerrederrorerseseructerugoeruptervilfragsfrailframefrancfrankfrapsfrassfratsfraudfraysfreakfreedfreerfreesfremdfrenafrerefreshfretsfriarfriedfrierfriesfrigsfrillfrisefriskfrithfritsfrittfritzfrizzfrockfroesfrogsfrondfronsfrontfrorefroshfrostfrothfrownfrowsfrozefrugsfruitfrumpfryergraalgrabsgracegradegradsgraftgrailgraingramagrampgramsgranagrandgransgrantgrapegraphgrapygraspgrassgrategravegravygraysgrazegreatgrebegreedgreekgreengreesgreetgregogreysgridegridsgriefgriffgriftgrigsgrillgrimegrimygrindgrinsgriotgripegripsgriptgripygristgrithgritsgroangroatgrogsgroingroomgropegrossgroszgrotsgroupgroutgrovegrowlgrowngrowsgrubsgruelgruesgruffgrumegrumpgruntiradeirateiridsiringirkedirokoironeironsironykraalkraftkraitkrautkreepkrillkronakronekroonkrubiorachoralsorangorateorbedorbitorcasorcinorderordosoreadorganorgicoribiorielorlesorlopormerornisorpinorrisorthoorzospraamprahupramsprangprankpraosprasepratepratsprausprawnprayspreedpreenpreesprepspresapresepressprestprexypreyspriceprickpricypridepriedprierpriesprigsprillprimaprimeprimiprimoprimpprimsprinkprintprionpriorpriseprismprissprivyprizeproasprobeprodsproemprofsprogsprolepromopromsproneprongproofpropsproseprosoprossprostprosyproudproveprowlprowsproxyprudepruneprutapryertracetracktracttradetragitraiktrailtraintraittramptramstranktranqtranstrapstrapttrashtrasstravetrawltraystreadtreattreedtreentreestrekstrendtresstretstrewstreystriactriadtrialtribetricetricktriedtriertriestrigotrigstriketrilltrimstrinetrioltriostripetripstritetroaktrocktrodetroistroketrolltromptronatronetrooptrooztropetrothtrotstrouttrovetrowstroystrucetrucktruedtruertruestrugstrulltrulytrumptrunktrusstrusttruthtrymatrysturaeiurareurariuraseurateurbanurbiaurealureasuredoureicurgedurgerurgesurialurineursaevroomvrouwvrowswrackwrangwrapswraptwrathwreakwreckwrenswrestwrickwriedwrierwrieswringwristwritewritswrongwrotewrothwrungwryerwryly