9-Letter Words Ending in H
204 9-letter words end in H, including establish, paragraph, telegraph, aftermath. All are playable in Scrabble-style games and useful for Wordle endings.
Highest scoring
- squawfish27
- chaffinch25
- jellyfish25
- xylograph25
- backbench24
- hemolymph24
- hypomorph24
- kymograph24
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list204
acritarchaftermathallographallomorphangelfishautographautotrophauxotrophayatollahbackbenchbackclothbackslashbaksheeshbandwidthbarographbatholithbillionthbitterishblackfishblindfishbloodbathblowtorchbrainwashbuckteethbucktoothbullfinchcereclothchaffinchcleverishcockroachcolocynthcopublishcranreuchcystolithdevilfishdishclothdisrelishdjellabahdragonishdropclothectomorpheightiethembellishendolymphendomorphergographestablishfaceclothfifteenthfootclothforereachforthwithgemutlichgibberishgiraffishglobefishgoalmouthgoldfinchgoldsmithgoosefishhaftarothhaftorothhaggadothhairbrushhairclothhalachothhellbrothhemistichhemolymphhemstitchholographhomeopathhomographhopscotchhoydenishhundredthhypomorphideographintermeshjargonishjellyfishkillifishkittenishkymographlabyrinthlaccolithlagomorphlickerishlocksmithlogographlogogriphloinclothloudmouthmacintoshmaharajahmatriarchmegadeathmeseemethmeshuggahmesomorphmicroinchmicrolithmillionthmonographmouthwashmultipathnailbrushninetiethnomographnonchurchnongrowthnonspeecholeographosteopathoutgrowthoutpreachovercoachovermatchoverreachoverweighparagraphparanymphparashothpatriarchperilymphplatyfishpolygraphpolymorphpolyptychpostcrashprelaunchpremonishprettyishrefurbishrefurnishreplenishrepublishsablefishsackclothsagebrushsailclothsallowishserigraphshellfishshillalahshophrothshtetlachsixteenthsnowbrushsociopathsongsmithsourdoughspadefishspearfishspicebushspiderishsquawfishsqueamishstalworthstatolithstockfishstonefishstopwatchstrongishsubbranchsuccotashsuperrichsurfperchswellfishswordfishtabboulehtallitothtelegraphterebinththerewiththirtieththirtyishthornbushtollboothtomboyishtopstitchtrierarchtrunkfishtunesmithtwentiethtypographultrahighultrarichumpteenthunbookishunselfishunstylishvampirishvulturishwashclothwherewithwhitefishwhitewashwordsmithworkbenchxylographyellowishyeshivothzillionth