Skip to content

Word lists

9-Letter Words Ending in H

204 9-letter words end in H, including establish, paragraph, telegraph, aftermath. All are playable in Scrabble-style games and useful for Wordle endings.

Highest scoring

  • squawfish27
  • chaffinch25
  • jellyfish25
  • xylograph25
  • backbench24
  • hemolymph24
  • hypomorph24
  • kymograph24

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list204

acritarchaftermathallographallomorphangelfishautographautotrophauxotrophayatollahbackbenchbackclothbackslashbaksheeshbandwidthbarographbatholithbillionthbitterishblackfishblindfishbloodbathblowtorchbrainwashbuckteethbucktoothbullfinchcereclothchaffinchcleverishcockroachcolocynthcopublishcranreuchcystolithdevilfishdishclothdisrelishdjellabahdragonishdropclothectomorpheightiethembellishendolymphendomorphergographestablishfaceclothfifteenthfootclothforereachforthwithgemutlichgibberishgiraffishglobefishgoalmouthgoldfinchgoldsmithgoosefishhaftarothhaftorothhaggadothhairbrushhairclothhalachothhellbrothhemistichhemolymphhemstitchholographhomeopathhomographhopscotchhoydenishhundredthhypomorphideographintermeshjargonishjellyfishkillifishkittenishkymographlabyrinthlaccolithlagomorphlickerishlocksmithlogographlogogriphloinclothloudmouthmacintoshmaharajahmatriarchmegadeathmeseemethmeshuggahmesomorphmicroinchmicrolithmillionthmonographmouthwashmultipathnailbrushninetiethnomographnonchurchnongrowthnonspeecholeographosteopathoutgrowthoutpreachovercoachovermatchoverreachoverweighparagraphparanymphparashothpatriarchperilymphplatyfishpolygraphpolymorphpolyptychpostcrashprelaunchpremonishprettyishrefurbishrefurnishreplenishrepublishsablefishsackclothsagebrushsailclothsallowishserigraphshellfishshillalahshophrothshtetlachsixteenthsnowbrushsociopathsongsmithsourdoughspadefishspearfishspicebushspiderishsquawfishsqueamishstalworthstatolithstockfishstonefishstopwatchstrongishsubbranchsuccotashsuperrichsurfperchswellfishswordfishtabboulehtallitothtelegraphterebinththerewiththirtieththirtyishthornbushtollboothtomboyishtopstitchtrierarchtrunkfishtunesmithtwentiethtypographultrahighultrarichumpteenthunbookishunselfishunstylishvampirishvulturishwashclothwherewithwhitefishwhitewashwordsmithworkbenchxylographyellowishyeshivothzillionth