Skip to content

Word lists

9-Letter Words Starting With F

1,015 9-letter words start with the letter F, including following, financial, fantastic, functions. Every word below is valid in Scrabble-style word games.

Highest scoring

  • frazzling31
  • frizzling31
  • frizziest30
  • frizzlers30
  • frizzlier30
  • fuzziness30
  • flapjacks27
  • frequency26

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list1,015

fabricantfabricatefabulistsfaceclothfacedownsfaceplatefacetiousfacettingfacsimilefacticityfactionalfactitivefactoragefactorialfactoriesfactoringfactorizefactotumsfactuallyfacultiesfadeawaysfaggotingfagotingsfahlbandsfailinglyfaineantsfaintnessfairishlyfairleadsfairyismsfairylandfairylikefaithfulsfaithlessfalchionsfalciformfalconersfalconetsfalconinefalderalsfalderolsfaldstoolfallaciesfallaleryfallawaysfallbacksfallowingfalsehoodfalsenessfalsettosfalseworkfalsifiedfalsifierfalsifiesfalsitiesfaltboatsfalterersfalteringfamiliarsfamilismsfamishingfanaticalfancifiedfancifiesfancinessfancyworkfandangosfanegadasfanfaronsfanfoldedfanlightsfantasiasfantasiedfantasiesfantasisefantasistfantasizefantasticfaradisedfaradisesfaradismsfaradizedfaradizesfarandolefarewellsfarmhandsfarmhousefarmlandsfarmsteadfarmwivesfarmworksfarmyardsfarnesolsfarnessesfarragoesfarrowingfarseeingfarthingsfasciatedfascicledfasciclesfasciculefasciculifascinatefascisticfashionedfashionerfastbacksfastballsfastenersfasteningfatalismsfatalistsfatefullyfatheadedfatheringfathomingfatidicalfatigablefatiguingfatnessesfatstocksfattenersfatteningfattinessfatuitiesfatuouslyfaubourgsfaultiestfaultlessfaunisticfauteuilsfavorablefavorablyfavoritesfavourersfavouringfawninglyfayalitesfearfullyfeasancesfeatheredfeatliestfeaturingfebrifugefeculencefecundatefecundityfederallyfederatedfederatesfeedbacksfeedboxesfeedholesfeedstockfeedstufffeelinglyfeetfirstfeistiestfeldshersfeldsparsfelicificfellaheenfellatingfellationfellatiosfellatorsfellowingfellowmanfellowmenfeloniousfelonriesfelstonesfemininesfeminisedfeminisesfeminismsfeministsfeminizedfeminizesfenaglingfencelessfencerowsfenciblesfenestraefenestralfenthionsfenugreekfeodariesfeoffmentfermentedfermenterfermentorferneriesferociousferrelingferrelledferretersferretingferriagesferritinsferroceneferrotypeferrulingferryboatfertilelyfertilityfertilizeferventlyfesteringfestinatefestivalsfestivelyfestivityfestoonedfetationsfeteritasfetichismfeticidesfetidnessfetishismfetishistfetoscopefetoscopyfetterersfetteringfettlingsfettucinefettucinifeudalismfeudalistfeudalityfeudalizefeudariesfeudatoryfeverfewsfeverwortfewnessesfeynessesfiberfillfiberizedfiberizesfibrannesfibrefillfibrillaefibrillarfibrinoidfibromatafictionalfictivelyfideisticfidgetersfidgetingfiduciaryfieldfarefieldworkfierinessfifteenthfiftiethsfigeatersfightingsfigulinesfigurantsfigurinesfilagreedfilagreesfilamentsfilariidsfilaturesfiliatingfiliationfilicidesfiligreedfiligreesfilistersfilletingfillipingfilmcardsfilmgoersfilminessfilmlandsfilmmakerfilmstripfilterersfilteringfilthiestfiltrablefiltratedfiltratesfimbriatefinaglersfinaglingfinalisedfinalisesfinalismsfinalistsfinalizedfinalizesfinancialfinancierfinancingfinessingfinfishesfingerersfingeringfingertipfinicallyfinickierfinickingfinishersfinishingfinitudesfinnmarksfinochiosfioriturafioriturefirebacksfireballsfirebasesfirebirdsfireboatsfirebombsfireboxesfirebrandfirebratsfirebreakfirebrickfireclaysfiredampsfiredrakefirefangsfirefightfirefliesfireguardfirehallsfirehousefirelightfirelocksfiremanicfirepinksfireplacefireplugsfirepowerfireprooffireroomsfiresidesfirestonefirestormfirethornfiretrapsfirewaterfireweedsfirewoodsfireworksfirewormsfirmamentfirmwaresfirstbornfirsthandfirstlingfishboltsfishbonesfishbowlsfisheriesfishermanfishermenfishhooksfishlinesfishmealsfishplatefishpolesfishpondsfishtailsfishwivesfishwormsfissilityfissionalfissionedfissipedsfissuringfistfightfistnotesfistulousfitnessesfittinglyfixationsfixativesfixednessflabbiestflabellumflaccidlyflagellarflagellinflagellumflageoletflaggiestflaggingsflagpolesflagranceflagrancyflagshipsflagstaffflagstickflagstoneflakinessflambeausflambeauxflambeingflamencosflameoutsflaminglyflamingosflammableflancardsflaneriesflanneledflannellyflapjacksflappableflappiestflaringlyflashbackflashbulbflashcardflashcubeflashgunsflashiestflashingsflashlampflashoverflashtubeflatboatsflatfootsflatheadsflatironsflatlandsflatlingsflatmatesflattenedflattenerflatteredflattererflatulentflatwaresflatworksflatwormsflauntersflauntierflauntingflautistsflavanolsflavanoneflavonoidflavonolsflavorersflavorfulflavoringflavoristflavouredflaxseedsfleabanesfleabitesfleawortsflechetteflectionsfledgiestfledglingfleechingfleeciestfleetnessflemishedflemishesflenchingfleshiestfleshingsfleshlierfleshmentfleshpotsfletchersfletchingflexagonsflexitimeflextimesflichtersflickeredflightierflightilyflightingflimflamsflimsiestflinchersflinchingflinkitesflintiestflintlikeflintlockflippancyflirtiestflitchingflitteredfloatagesfloatiestflocculesflocculusflockiestflockingsfloggingsfloodgatefloodwaysflooragesflooringsflophouseflopoversfloppiestflorencesfloriatedfloridityflorigensfloristicfloristryflossiestflotationflotillasflouncierflouncingfloundersflourlessflowchartflowerageflowerersfloweretsflowerfulflowerierflowerilyfloweringflowerpotflowinglyflowmeterflowstonefluctuantfluctuatefluenciesfluffiestfluidallyfluidisedfluidisesfluidizedfluidizerfluidizesfluidnessfluidramsflummoxedflummoxesfluorenesfluorescefluoridesfluorinesfluoritesfluorosesfluorosisfluoroticfluorsparflurryingflushableflushnessflusteredflutelikeflutteredfluttererfluxgatesfluxionalflybridgeflyleavesflypapersflyspecksflyweightflywheelsfoaminessfocacciasfocalisedfocalisesfocalizedfocalizesfocusablefocuslessfocussingfodderingfogfruitsfogginessfoldboatsfolderolsfoliatingfoliationfolklivesfolkloresfolkloricfolkmootsfolkmotesfolksiestfolktalesfolliclesfollowersfollowingfomentersfomentingfondlingsfontanelsfoodstufffoofarawsfooleriesfoolhardyfoolisherfoolishlyfoolprooffoolscapsfootballsfootbathsfootboardfootclothfootfallsfootfaultfootgearsfoothillsfootholdsfootloosefootmarksfootnotedfootnotesfootpacesfootpathsfootprintfootracesfootrestsfootropesfootslogsfootstepsfootstonefootstoolfootwallsfootworksfopperiesfoppishlyforaminalforbearerforbidalsforbiddenforbidderforbodingforcelessforcemeatforearmedforebearsforebodedforeboderforebodesforeboomsforebrainforecastsforecheckforecloseforecourtforedatedforedatesforedecksforedoingforedoomsforefacesforefeelsforefendsforefrontforegoersforegoingforehandsforeheadsforehoofsforeignerforejudgeforeknownforeknowsforelandsforelimbsforelocksforemastsforemilksforenamedforenamesforenoonsforensicsforepartsforepeaksforeplaysforeranksforereachforesailsforeseersforeshankforesheetforeshockforeshoreforeshownforeshowsforesidesforesightforeskinsforespeakforespokeforestageforestallforestaysforestersforestialforestingforeswearforesworeforeswornforetasteforetellsforetimesforetokenforewarnsforewingsforewomanforewomenforewordsforeyardsforfeitedforfeiterforfendedforgatherforgeableforgeriesforgetfulforgetiveforgetterforgiversforgivingforgottenforjudgedforjudgesforkballsforkliftsforlornerforlornlyformalinsformaliseformalismformalistformalityformalizeformamideformationformativeformattedformatterformicaryformulaicformularyformulateformulizeformworksfornicateforrarderforsakersforsakingforswearsforsythiafortaliceforthwithfortiethsfortifiedfortifierfortifiesfortitudefortnightfortunatefortuningforwardedforwarderforwardlyforzandosfossettesfossickedfossickerfossilisefossilizefossorialfosteragefosterersfosteringfoulbroodfounderedfoundlingfoundriesfountainsfourscorefoursomesfourteensfoveoletsfowlpoxesfoxfishesfoxglovesfoxhoundsfoxhuntedfoxhunterfractionsfractiousfracturedfracturesfraggingsfragilityfragmentsfragrancefragrancyfrailnessfrailtiesframbesiaframboiseframeableframeworkfranchisefranciumsfrancolinfrangiblefranglaisfrankablefrankfurtfranklinsfranknessfraternalfraughtedfrauleinsfrazzlingfreakiestfreakoutsfrecklierfrecklingfreebasedfreebaserfreebasesfreeboardfreebootsfreeholdsfreelancefreeloadsfreestonefreestylefreewheelfreightedfreighterfrenchifyfrenchingfreneticsfrenulumsfrenzyingfrequencefrequencyfrequentsfrescoersfrescoingfreshenedfreshenerfreshnessfretfullyfrettiestfretworksfribblersfribblingfricasseefricativefrictionsfriedcakefriendingfrightensfrightfulfrightingfrigidityfrilliestfrillingsfringiestfrisettesfriskiestfrittatasfritteredfrittererfrivolersfrivolingfrivolityfrivolledfrivollerfrivolousfrizettesfrizziestfrizzlersfrizzlierfrizzlingfroggiestfrolickedfrondeursfrontagesfrontallyfrontiersfrontlessfrontletsfrontlinefrontwardfrostbitefrostiestfrostingsfrostworkfrothiestfrottagesfrotteursfroufrousfrouncingfrouziestfrowardlyfrowsiestfrowstierfrowstingfrowziestfructosesfructuousfrugalityfrugivorefruitagesfruitcakefruitererfruitiestfruitionsfruitlessfruitletsfruitwoodfrumpiestfrustratefrustulesfruticosefuchsinesfuelwoodsfugaciousfugitivesfulfilledfulfillerfulgentlyfulgurantfulguratefulguritefulgurousfullbacksfullerenefulleriesfulleringfullfacesfulminantfulminatefulminingfulnessesfulsomelyfumarasesfumaratesfumarolesfumarolicfumigantsfumigatedfumigatesfumigatorfunctionsfundamentfungiblesfungicidefungiformfunicularfuniculusfunkinessfunnelingfunnelledfunninessfuranosesfurbearerfurbelowsfurbishedfurbisherfurbishesfurcatingfurcationfurcraeasfurfuralsfurfuransfuriouslyfurloughsfurmetiesfurmitiesfurnacingfurnishedfurnisherfurnishesfurniturefurrinersfurrowersfurrowingfurtheredfurthererfurtivelyfurunclesfuselagesfusileersfusiliersfusilladefusionistfussinessfustigatefustinessfusulinidfuturismsfuturistsfuzziness