9-Letter Words Starting With F
1,015 9-letter words start with the letter F, including following, financial, fantastic, functions. Every word below is valid in Scrabble-style word games.
Highest scoring
- frazzling31
- frizzling31
- frizziest30
- frizzlers30
- frizzlier30
- fuzziness30
- flapjacks27
- frequency26
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list1,015
fabricantfabricatefabulistsfaceclothfacedownsfaceplatefacetiousfacettingfacsimilefacticityfactionalfactitivefactoragefactorialfactoriesfactoringfactorizefactotumsfactuallyfacultiesfadeawaysfaggotingfagotingsfahlbandsfailinglyfaineantsfaintnessfairishlyfairleadsfairyismsfairylandfairylikefaithfulsfaithlessfalchionsfalciformfalconersfalconetsfalconinefalderalsfalderolsfaldstoolfallaciesfallaleryfallawaysfallbacksfallowingfalsehoodfalsenessfalsettosfalseworkfalsifiedfalsifierfalsifiesfalsitiesfaltboatsfalterersfalteringfamiliarsfamilismsfamishingfanaticalfancifiedfancifiesfancinessfancyworkfandangosfanegadasfanfaronsfanfoldedfanlightsfantasiasfantasiedfantasiesfantasisefantasistfantasizefantasticfaradisedfaradisesfaradismsfaradizedfaradizesfarandolefarewellsfarmhandsfarmhousefarmlandsfarmsteadfarmwivesfarmworksfarmyardsfarnesolsfarnessesfarragoesfarrowingfarseeingfarthingsfasciatedfascicledfasciclesfasciculefasciculifascinatefascisticfashionedfashionerfastbacksfastballsfastenersfasteningfatalismsfatalistsfatefullyfatheadedfatheringfathomingfatidicalfatigablefatiguingfatnessesfatstocksfattenersfatteningfattinessfatuitiesfatuouslyfaubourgsfaultiestfaultlessfaunisticfauteuilsfavorablefavorablyfavoritesfavourersfavouringfawninglyfayalitesfearfullyfeasancesfeatheredfeatliestfeaturingfebrifugefeculencefecundatefecundityfederallyfederatedfederatesfeedbacksfeedboxesfeedholesfeedstockfeedstufffeelinglyfeetfirstfeistiestfeldshersfeldsparsfelicificfellaheenfellatingfellationfellatiosfellatorsfellowingfellowmanfellowmenfeloniousfelonriesfelstonesfemininesfeminisedfeminisesfeminismsfeministsfeminizedfeminizesfenaglingfencelessfencerowsfenciblesfenestraefenestralfenthionsfenugreekfeodariesfeoffmentfermentedfermenterfermentorferneriesferociousferrelingferrelledferretersferretingferriagesferritinsferroceneferrotypeferrulingferryboatfertilelyfertilityfertilizeferventlyfesteringfestinatefestivalsfestivelyfestivityfestoonedfetationsfeteritasfetichismfeticidesfetidnessfetishismfetishistfetoscopefetoscopyfetterersfetteringfettlingsfettucinefettucinifeudalismfeudalistfeudalityfeudalizefeudariesfeudatoryfeverfewsfeverwortfewnessesfeynessesfiberfillfiberizedfiberizesfibrannesfibrefillfibrillaefibrillarfibrinoidfibromatafictionalfictivelyfideisticfidgetersfidgetingfiduciaryfieldfarefieldworkfierinessfifteenthfiftiethsfigeatersfightingsfigulinesfigurantsfigurinesfilagreedfilagreesfilamentsfilariidsfilaturesfiliatingfiliationfilicidesfiligreedfiligreesfilistersfilletingfillipingfilmcardsfilmgoersfilminessfilmlandsfilmmakerfilmstripfilterersfilteringfilthiestfiltrablefiltratedfiltratesfimbriatefinaglersfinaglingfinalisedfinalisesfinalismsfinalistsfinalizedfinalizesfinancialfinancierfinancingfinessingfinfishesfingerersfingeringfingertipfinicallyfinickierfinickingfinishersfinishingfinitudesfinnmarksfinochiosfioriturafioriturefirebacksfireballsfirebasesfirebirdsfireboatsfirebombsfireboxesfirebrandfirebratsfirebreakfirebrickfireclaysfiredampsfiredrakefirefangsfirefightfirefliesfireguardfirehallsfirehousefirelightfirelocksfiremanicfirepinksfireplacefireplugsfirepowerfireprooffireroomsfiresidesfirestonefirestormfirethornfiretrapsfirewaterfireweedsfirewoodsfireworksfirewormsfirmamentfirmwaresfirstbornfirsthandfirstlingfishboltsfishbonesfishbowlsfisheriesfishermanfishermenfishhooksfishlinesfishmealsfishplatefishpolesfishpondsfishtailsfishwivesfishwormsfissilityfissionalfissionedfissipedsfissuringfistfightfistnotesfistulousfitnessesfittinglyfixationsfixativesfixednessflabbiestflabellumflaccidlyflagellarflagellinflagellumflageoletflaggiestflaggingsflagpolesflagranceflagrancyflagshipsflagstaffflagstickflagstoneflakinessflambeausflambeauxflambeingflamencosflameoutsflaminglyflamingosflammableflancardsflaneriesflanneledflannellyflapjacksflappableflappiestflaringlyflashbackflashbulbflashcardflashcubeflashgunsflashiestflashingsflashlampflashoverflashtubeflatboatsflatfootsflatheadsflatironsflatlandsflatlingsflatmatesflattenedflattenerflatteredflattererflatulentflatwaresflatworksflatwormsflauntersflauntierflauntingflautistsflavanolsflavanoneflavonoidflavonolsflavorersflavorfulflavoringflavoristflavouredflaxseedsfleabanesfleabitesfleawortsflechetteflectionsfledgiestfledglingfleechingfleeciestfleetnessflemishedflemishesflenchingfleshiestfleshingsfleshlierfleshmentfleshpotsfletchersfletchingflexagonsflexitimeflextimesflichtersflickeredflightierflightilyflightingflimflamsflimsiestflinchersflinchingflinkitesflintiestflintlikeflintlockflippancyflirtiestflitchingflitteredfloatagesfloatiestflocculesflocculusflockiestflockingsfloggingsfloodgatefloodwaysflooragesflooringsflophouseflopoversfloppiestflorencesfloriatedfloridityflorigensfloristicfloristryflossiestflotationflotillasflouncierflouncingfloundersflourlessflowchartflowerageflowerersfloweretsflowerfulflowerierflowerilyfloweringflowerpotflowinglyflowmeterflowstonefluctuantfluctuatefluenciesfluffiestfluidallyfluidisedfluidisesfluidizedfluidizerfluidizesfluidnessfluidramsflummoxedflummoxesfluorenesfluorescefluoridesfluorinesfluoritesfluorosesfluorosisfluoroticfluorsparflurryingflushableflushnessflusteredflutelikeflutteredfluttererfluxgatesfluxionalflybridgeflyleavesflypapersflyspecksflyweightflywheelsfoaminessfocacciasfocalisedfocalisesfocalizedfocalizesfocusablefocuslessfocussingfodderingfogfruitsfogginessfoldboatsfolderolsfoliatingfoliationfolklivesfolkloresfolkloricfolkmootsfolkmotesfolksiestfolktalesfolliclesfollowersfollowingfomentersfomentingfondlingsfontanelsfoodstufffoofarawsfooleriesfoolhardyfoolisherfoolishlyfoolprooffoolscapsfootballsfootbathsfootboardfootclothfootfallsfootfaultfootgearsfoothillsfootholdsfootloosefootmarksfootnotedfootnotesfootpacesfootpathsfootprintfootracesfootrestsfootropesfootslogsfootstepsfootstonefootstoolfootwallsfootworksfopperiesfoppishlyforaminalforbearerforbidalsforbiddenforbidderforbodingforcelessforcemeatforearmedforebearsforebodedforeboderforebodesforeboomsforebrainforecastsforecheckforecloseforecourtforedatedforedatesforedecksforedoingforedoomsforefacesforefeelsforefendsforefrontforegoersforegoingforehandsforeheadsforehoofsforeignerforejudgeforeknownforeknowsforelandsforelimbsforelocksforemastsforemilksforenamedforenamesforenoonsforensicsforepartsforepeaksforeplaysforeranksforereachforesailsforeseersforeshankforesheetforeshockforeshoreforeshownforeshowsforesidesforesightforeskinsforespeakforespokeforestageforestallforestaysforestersforestialforestingforeswearforesworeforeswornforetasteforetellsforetimesforetokenforewarnsforewingsforewomanforewomenforewordsforeyardsforfeitedforfeiterforfendedforgatherforgeableforgeriesforgetfulforgetiveforgetterforgiversforgivingforgottenforjudgedforjudgesforkballsforkliftsforlornerforlornlyformalinsformaliseformalismformalistformalityformalizeformamideformationformativeformattedformatterformicaryformulaicformularyformulateformulizeformworksfornicateforrarderforsakersforsakingforswearsforsythiafortaliceforthwithfortiethsfortifiedfortifierfortifiesfortitudefortnightfortunatefortuningforwardedforwarderforwardlyforzandosfossettesfossickedfossickerfossilisefossilizefossorialfosteragefosterersfosteringfoulbroodfounderedfoundlingfoundriesfountainsfourscorefoursomesfourteensfoveoletsfowlpoxesfoxfishesfoxglovesfoxhoundsfoxhuntedfoxhunterfractionsfractiousfracturedfracturesfraggingsfragilityfragmentsfragrancefragrancyfrailnessfrailtiesframbesiaframboiseframeableframeworkfranchisefranciumsfrancolinfrangiblefranglaisfrankablefrankfurtfranklinsfranknessfraternalfraughtedfrauleinsfrazzlingfreakiestfreakoutsfrecklierfrecklingfreebasedfreebaserfreebasesfreeboardfreebootsfreeholdsfreelancefreeloadsfreestonefreestylefreewheelfreightedfreighterfrenchifyfrenchingfreneticsfrenulumsfrenzyingfrequencefrequencyfrequentsfrescoersfrescoingfreshenedfreshenerfreshnessfretfullyfrettiestfretworksfribblersfribblingfricasseefricativefrictionsfriedcakefriendingfrightensfrightfulfrightingfrigidityfrilliestfrillingsfringiestfrisettesfriskiestfrittatasfritteredfrittererfrivolersfrivolingfrivolityfrivolledfrivollerfrivolousfrizettesfrizziestfrizzlersfrizzlierfrizzlingfroggiestfrolickedfrondeursfrontagesfrontallyfrontiersfrontlessfrontletsfrontlinefrontwardfrostbitefrostiestfrostingsfrostworkfrothiestfrottagesfrotteursfroufrousfrouncingfrouziestfrowardlyfrowsiestfrowstierfrowstingfrowziestfructosesfructuousfrugalityfrugivorefruitagesfruitcakefruitererfruitiestfruitionsfruitlessfruitletsfruitwoodfrumpiestfrustratefrustulesfruticosefuchsinesfuelwoodsfugaciousfugitivesfulfilledfulfillerfulgentlyfulgurantfulguratefulguritefulgurousfullbacksfullerenefulleriesfulleringfullfacesfulminantfulminatefulminingfulnessesfulsomelyfumarasesfumaratesfumarolesfumarolicfumigantsfumigatedfumigatesfumigatorfunctionsfundamentfungiblesfungicidefungiformfunicularfuniculusfunkinessfunnelingfunnelledfunninessfuranosesfurbearerfurbelowsfurbishedfurbisherfurbishesfurcatingfurcationfurcraeasfurfuralsfurfuransfuriouslyfurloughsfurmetiesfurmitiesfurnacingfurnishedfurnisherfurnishesfurniturefurrinersfurrowersfurrowingfurtheredfurthererfurtivelyfurunclesfuselagesfusileersfusiliersfusilladefusionistfussinessfustigatefustinessfusulinidfuturismsfuturistsfuzziness