Skip to content

Word lists

Words With CL

2,363 words contain the letter pair CL, including including, class, close, clear. Most common first.

Highest scoring

  • cyclohexylamine37
  • cycloheximides34
  • cycloheximide33
  • oxytetracycline32
  • cyclohexanones31
  • reacclimatizing31
  • cyclazocines30
  • doxycyclines30

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first2,363

Showing the 400 most common of 2,363 words. The length links below give complete lists.

includingclasscloseclearincludeclubarticleincludedcleanincludesclaimclearlyclosedclaimsclickclassesvehicleclosernuclearclassicclothesclimatearticlesclaimedvehiclescycleexclusivecircledeclaredclientcloselyclubsclinicalclothingcloudclosinguncleclientsmuscleclockdeclineconclusioncleaningconcludedclaimingclaypubliclyclipclassicalclassifiedexclusivelyclimbcleverclinicclosestdeclinedclearedclueclassificationcloudsclassroommusclesclosetcirclesmiracleclimbingclosurecliffcyclingdeclarationparticlesmotorcycledeclareclipsclearingclothcleanedinclusionclerkdisclosureconclusionsclauseclusterbicycleclanclashinclusiveclosesclearanceclowncyclesunclearexcludingclickingclaritycleanerclassicsconcludeparticleexcludedclutchobstaclesinclinedclarifyclimbeddisclosedecliningcluesdeclaringeclipsedisclosedclinicsexcludeproclaimedmiraclesconcludesrecyclingclergyenclosedclearerclassyclicksobstacleclarencedeclaresoracleacclaimedchroniclecyclistscloneclustersexclusionclassroomscliffsnightclubchroniclesclassmatesenclosurespectacleclimaxclippersclawnucleuscladclockscyclistcloakclawsclearsclickedrecycledcleansingcloudyclapconcludingclarificationclashesdeclinesencyclopediacycloneclownscluelessclingclarifiedmotorcyclesecclesiasticalcleansecleanupcleanersdisclaimerclampclanspinnacleclumsyclausesreclaimproclamationclementclimbsclubhouseforeclosureclonesbicyclescleavageclassifyclinicallyclericexcludesclosureseclecticinclinationundisclosedcloverclappingclingingrecycleclericalunclesclassmatecirclingclimatesreclaimedclerksclassedsclerosisconclusiveclinchacclaimclippedcloggedclimbersproclaimcliniciansdisclosuresclothedclaimantscleanlinesscleanssecludedcloutcloningdeclarationsclamclienteleproclaimingclutterdebacleclarifyingclandestinenomenclatureclimaticclockwiseclockworktentaclesclotnucleienclaveclippingdisclosingclockedcleverlytesticlesclassificationscircledclimberclinchedclergymanclutchingclichecyclicclutchescyclicalcliqueinclineclaimantclosenessreclamationclamsinconclusiveclashedclarinetclappedclericscyclopsnightclubsspectaclesclaspclothsclusteredexclamationenclosuresclonedclovescubicleclearancesexclusivityclipperclosetscloudeduncleancleansertabernacleexclaimedclampscleaverclearestprecludeclusteringreclaimingcleanlycyclonessubclassclippingsnucleotideclogclubbingeclipsedclassicallyclungclinicianconclusivelyclotscleansedclemencyclarifiesproclaimsclitorisclassifyingclagclefclewclodclonclopcloyclachclackcladecladsclagsclangclankclapsclaptclaroclaryclastclaveclaviclayscleatcleekclefscleftclepecleptclewscliftclimeclineclinkcliptclodsclogsclombclompclonkclonsclootclopsclourclovecloysclozecluckcluedclumpclunkcycloeclatmaclesoclebeclogbouclechiclechiclyclachsclackscladesclammyclamorclangsclanksclaqueclaretclarosclaspsclasptclastsclaverclavesclavusclawedclawerclaxonclayedclayeycleatscleavecleekscleftsclenchcleomeclepedclepescleridclevisclewedcliffyclifts