Words With CL
2,363 words contain the letter pair CL, including including, class, close, clear. Most common first.
Highest scoring
- cyclohexylamine37
- cycloheximides34
- cycloheximide33
- oxytetracycline32
- cyclohexanones31
- reacclimatizing31
- cyclazocines30
- doxycyclines30
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first2,363
Showing the 400 most common of 2,363 words. The length links below give complete lists.
includingclasscloseclearincludeclubarticleincludedcleanincludesclaimclearlyclosedclaimsclickclassesvehicleclosernuclearclassicclothesclimatearticlesclaimedvehiclescycleexclusivecircledeclaredclientcloselyclubsclinicalclothingcloudclosinguncleclientsmuscleclockdeclineconclusioncleaningconcludedclaimingclaypubliclyclipclassicalclassifiedexclusivelyclimbcleverclinicclosestdeclinedclearedclueclassificationcloudsclassroommusclesclosetcirclesmiracleclimbingclosurecliffcyclingdeclarationparticlesmotorcycledeclareclipsclearingclothcleanedinclusionclerkdisclosureconclusionsclauseclusterbicycleclanclashinclusiveclosesclearanceclowncyclesunclearexcludingclickingclaritycleanerclassicsconcludeparticleexcludedclutchobstaclesinclinedclarifyclimbeddisclosedecliningcluesdeclaringeclipsedisclosedclinicsexcludeproclaimedmiraclesconcludesrecyclingclergyenclosedclearerclassyclicksobstacleclarencedeclaresoracleacclaimedchroniclecyclistscloneclustersexclusionclassroomscliffsnightclubchroniclesclassmatesenclosurespectacleclimaxclippersclawnucleuscladclockscyclistcloakclawsclearsclickedrecycledcleansingcloudyclapconcludingclarificationclashesdeclinesencyclopediacycloneclownscluelessclingclarifiedmotorcyclesecclesiasticalcleansecleanupcleanersdisclaimerclampclanspinnacleclumsyclausesreclaimproclamationclementclimbsclubhouseforeclosureclonesbicyclescleavageclassifyclinicallyclericexcludesclosureseclecticinclinationundisclosedcloverclappingclingingrecycleclericalunclesclassmatecirclingclimatesreclaimedclerksclassedsclerosisconclusiveclinchacclaimclippedcloggedclimbersproclaimcliniciansdisclosuresclothedclaimantscleanlinesscleanssecludedcloutcloningdeclarationsclamclienteleproclaimingclutterdebacleclarifyingclandestinenomenclatureclimaticclockwiseclockworktentaclesclotnucleienclaveclippingdisclosingclockedcleverlytesticlesclassificationscircledclimberclinchedclergymanclutchingclichecyclicclutchescyclicalcliqueinclineclaimantclosenessreclamationclamsinconclusiveclashedclarinetclappedclericscyclopsnightclubsspectaclesclaspclothsclusteredexclamationenclosuresclonedclovescubicleclearancesexclusivityclipperclosetscloudeduncleancleansertabernacleexclaimedclampscleaverclearestprecludeclusteringreclaimingcleanlycyclonessubclassclippingsnucleotideclogclubbingeclipsedclassicallyclungclinicianconclusivelyclotscleansedclemencyclarifiesproclaimsclitorisclassifyingclagclefclewclodclonclopcloyclachclackcladecladsclagsclangclankclapsclaptclaroclaryclastclaveclaviclayscleatcleekclefscleftclepecleptclewscliftclimeclineclinkcliptclodsclogsclombclompclonkclonsclootclopsclourclovecloysclozecluckcluedclumpclunkcycloeclatmaclesoclebeclogbouclechiclechiclyclachsclackscladesclammyclamorclangsclanksclaqueclaretclarosclaspsclasptclastsclaverclavesclavusclawedclawerclaxonclayedclayeycleatscleavecleekscleftsclenchcleomeclepedclepescleridclevisclewedcliffyclifts