Words With DS
2,698 words contain the letter pair DS, including friends, needs, kids, words. Most common first.
Highest scoring
- isocarboxazids35
- buzzwords33
- blizzards30
- buzzards29
- mazzards29
- gizzards28
- jacquards28
- crazyweeds28
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first2,698
Showing the 400 most common of 2,698 words. The length links below give complete lists.
friendsneedskidswordshandstowardssoundsrecordssecondsstandardsthousandscardsendsfundsawardsmethodsheadsleadsfindsstandshundredsbirdsgoodsholdsfieldsroadspoundsdependskindsyardsislandsmindswoodsgroundsafterwardsfoodsdemandsgodsfriendshipaddsbandslandslandscapeperiodsadsbrandsguardstrendsboardsroundsoddsseedsbondsaidsreadsworldsloadswindsremindshandsomeregardsbedscloudssendshouseholdsunderstandstendsrewardslordswoundslegendsspeedsproceedsweekendsbackwardsdiamondsextendscompoundsoldscommandsbuildsspendsneighborhoodsredsthirdsfeedsmidstraidsyieldsbidscrowdsshieldsladsmindsetacidsthreadsgrandsonsandsforwardsrespondsdeedsbackgroundsfloodspadshusbandsrecommendsswordsreboundsupwardsfluidslandscapesdividendsbeadsintendsspreadsmidlandsboundsbreedsgirlfriendsfriendshipshighlandswardsrapidshazardsbudsdadsbastardsredskinsdownloadswizardsonwardsrodsexceedsexpandssteroidslandlordspasswordssandstoneamidsthardshipsquadsheadsetcorrespondsfedsweedsdefendsavoidschordsattendsshedsliquidscrossroadssucceedslandsliderailroadspondssurroundspodsroadsideboyfriendsfoldskeywordswindshieldstrandsglandswetlandsbindskeyboardssafeguardsmoodshybridsrefundsidslendsnerdshandshakevineyardscordsbedsidemodsbendsstudsblendshindsightsolidscowardspyramidshardshipsamendspretendssaladsspreadsheetnodsblindserrandsbeardslordshipbloodshedbillboardsalmondspostcardsmaidslizardsgladstonewoodlandsmoundsshepherdslandscapingstewardshipherdsgoldsmithasteroidsdownwardshoundsstewardspleadsshredsballadseyelidscontendsdescendsorchardsbloodstreamunfoldsthresholdsaccordsombudsmanbodyguardslidsgoldsgridsforbidsuploadsmoldsorchidsgrandkidsmidsummerbridesmaidshoodsplaygroundsguildshandsetshardsaffordsopioidsstandstilllivelihoodsbleedsbloodsfraudsreedsroadshowwarheadsbraidstranscendsoffendsoutwardsnomadsborderlandscoldsheadsetswarlordslandslidesshipyardsbreadslipidsgrasslandsloudspeakerodsandsbadsbodscadscodscudsdudseldsfadsfidsfudsgadsgedsgidshodsmadsmidsmudsoudspedspudsradsridssodssudstadstedstodsurdswadswedsyidsyodszedsamidsapodsbaldsbardsbaudsbawdsboldsbradsbundsburdscaidschadscladsclodscoedscrudscurdsdeadsdidstduadsdyadsegadsemydsfardsfendsfeodsfeudsfondsfordsgaudsgeldsgildsgirdsgladsgledsgoadsgowdsgradsguidshadsthardsheedshindshurdsimidsiridslardslaudsleudsmaudsmeadsmeedsmeldsmendsnardsnurdsoxidspardspendsplodspoodsprodsqaidsquadsquidsquodsrandsreddsrendsrindsroodsruddsryndssaidssardsscadsscudsshadssildsskidssledssnedssordsspudssuddssudsysurdsthudstoadsturdsveldsvendsvoidswandsweldswendswhids