Skip to content

Word lists

Words With DS

2,698 words contain the letter pair DS, including friends, needs, kids, words. Most common first.

Highest scoring

  • isocarboxazids35
  • buzzwords33
  • blizzards30
  • buzzards29
  • mazzards29
  • gizzards28
  • jacquards28
  • crazyweeds28

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first2,698

Showing the 400 most common of 2,698 words. The length links below give complete lists.

friendsneedskidswordshandstowardssoundsrecordssecondsstandardsthousandscardsendsfundsawardsmethodsheadsleadsfindsstandshundredsbirdsgoodsholdsfieldsroadspoundsdependskindsyardsislandsmindswoodsgroundsafterwardsfoodsdemandsgodsfriendshipaddsbandslandslandscapeperiodsadsbrandsguardstrendsboardsroundsoddsseedsbondsaidsreadsworldsloadswindsremindshandsomeregardsbedscloudssendshouseholdsunderstandstendsrewardslordswoundslegendsspeedsproceedsweekendsbackwardsdiamondsextendscompoundsoldscommandsbuildsspendsneighborhoodsredsthirdsfeedsmidstraidsyieldsbidscrowdsshieldsladsmindsetacidsthreadsgrandsonsandsforwardsrespondsdeedsbackgroundsfloodspadshusbandsrecommendsswordsreboundsupwardsfluidslandscapesdividendsbeadsintendsspreadsmidlandsboundsbreedsgirlfriendsfriendshipshighlandswardsrapidshazardsbudsdadsbastardsredskinsdownloadswizardsonwardsrodsexceedsexpandssteroidslandlordspasswordssandstoneamidsthardshipsquadsheadsetcorrespondsfedsweedsdefendsavoidschordsattendsshedsliquidscrossroadssucceedslandsliderailroadspondssurroundspodsroadsideboyfriendsfoldskeywordswindshieldstrandsglandswetlandsbindskeyboardssafeguardsmoodshybridsrefundsidslendsnerdshandshakevineyardscordsbedsidemodsbendsstudsblendshindsightsolidscowardspyramidshardshipsamendspretendssaladsspreadsheetnodsblindserrandsbeardslordshipbloodshedbillboardsalmondspostcardsmaidslizardsgladstonewoodlandsmoundsshepherdslandscapingstewardshipherdsgoldsmithasteroidsdownwardshoundsstewardspleadsshredsballadseyelidscontendsdescendsorchardsbloodstreamunfoldsthresholdsaccordsombudsmanbodyguardslidsgoldsgridsforbidsuploadsmoldsorchidsgrandkidsmidsummerbridesmaidshoodsplaygroundsguildshandsetshardsaffordsopioidsstandstilllivelihoodsbleedsbloodsfraudsreedsroadshowwarheadsbraidstranscendsoffendsoutwardsnomadsborderlandscoldsheadsetswarlordslandslidesshipyardsbreadslipidsgrasslandsloudspeakerodsandsbadsbodscadscodscudsdudseldsfadsfidsfudsgadsgedsgidshodsmadsmidsmudsoudspedspudsradsridssodssudstadstedstodsurdswadswedsyidsyodszedsamidsapodsbaldsbardsbaudsbawdsboldsbradsbundsburdscaidschadscladsclodscoedscrudscurdsdeadsdidstduadsdyadsegadsemydsfardsfendsfeodsfeudsfondsfordsgaudsgeldsgildsgirdsgladsgledsgoadsgowdsgradsguidshadsthardsheedshindshurdsimidsiridslardslaudsleudsmaudsmeadsmeedsmeldsmendsnardsnurdsoxidspardspendsplodspoodsprodsqaidsquadsquidsquodsrandsreddsrendsrindsroodsruddsryndssaidssardsscadsscudsshadssildsskidssledssnedssordsspudssuddssudsysurdsthudstoadsturdsveldsvendsvoidswandsweldswendswhids