Words With EL
7,714 words contain the letter pair EL, including well, help, feel, tell. Most common first.
Highest scoring
- weltschmerzes32
- zooxanthellae32
- mozzarellas31
- zooxanthella31
- psychedelically31
- sculpturesquely31
- mozzarella30
- exquisitely30
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first7,714
Showing the 400 most common of 7,714 words. The length links below give complete lists.
wellhelpfeeltellbelievelevelelsemyselfyourselfdevelopmentselfhimselfheldfieldlikelythemselvesrelationshipfeltmodelfeelinghellitselfrelatedreleaseelectionbelowreleasedtravelcompletelywelcomesellabsolutelyimmediatelylevelsdefinitelyhoteldevelopedtellingfeelshelpedcellfellchannelreligioussellingextremelytelevisiontellshelpingherselffellowcellsdevelopbelievedhelpslovelymodelsreligionexcellentfuelhelloelectricentirelysteelfeelingselementsintelligenceyellowselectedrelationshipsrelationselectionsdevelopingrelativelyapproximatelynovelelecteddeliveredourselvesselectionunfortunatelylargelyrelevantfieldsbelldeliveryultimatelyelpersonnelpanelreliefsurelydeliverelectronicwidelycloselywheelsmellbarelycelebrateeffectivelyrelativebeliefelementelsewhereangelselectrespectivelykellylabelhelpfulwelfarebelieveselectricitybeltrarelyelectricallatelycoloneltelephonedelayeliteshellbelongchannelsspellmerelytwelvedelicioussatelliteelementarydelreleasesrelationunlikelyshieldintellectualrelyrelaxeligiblereliablecelebritycelebrationintelligentvesselparalleltravelingangelshomelesswellslonelywheelsbeliefsshelterguidelinesneverthelessnelsonrelatetunnelbelongscelebratedexclusivelyactivelydeletehotelssafelyuselesscancelleddevelopersdevelopmentsrelatingsolelydelayedvesselswirelessdeveloperpreciselyrelativeselectronicscancelgospeldeletedbarrelbelovedcelebratingyieldmarvelcounseltravellingpreliminarywelshelderlytimelinebelievingeliminatereleasingchancellorhelicoptercrueldeltaelevenjewelryelectoralselfishbellynovelspurelyseverelygenuinelysellsdelighteddeliveringrebellabelselephantseparatelycelebritiesoverwhelmingunbelievablefreelynicelyrebelsexcellenceelderheelspanelstraveledelaboratedieseltravelsbelongingeliminatedsmellsyellingpipelinenonethelesselectchapelelevatedshelfhelmetnamelydeliberatelysellerrelaxedbelongeddelicateprivatelyspellingtelegraphaccuratelydelayssequeltravelledcompellingirrelevantdesperatelydelightbachelorfortunatelymeltwelcomedrevelationelegantelevatorhomelandrelievedtowelmodelingdelegatesrebellionshellsbattlefieldeliminationvelocitydelegationreliabilitylabeledreligionslikelihoodtelbellscanceledrelaxingelevationyieldscellulardevelopsfarewellumbrellasincerelycounselingpositivelyselectiveoverwhelmedshieldsextensivelyrelaylivelydeliversenvelopefellowshipmidfielderwheelchairyourselvescorrelationyelltimelycelebrationsgelheelelbowsellerstravelersbarrelsfuelsnickelreliedspellsfellowsrelatestunnelselectrondeliberatecollectivelymelodyreliesrelyingrelianceelephantsreluctantselectingalternativelymelpeelmeltingskeletonunrelatedbellespelledcounseloreliminatingmelteddevelopmentaljellyfelonyvelvetmaxwellrelievewheelerwelcomingdelightfulsatelliteseldersyelledcrueltyshelvesstellarcelebratescancellationlifelongremotelyrelevancetelescopeacceleratedeligibilitybeltsdwellingjewelleryappropriatelyexcelaccelerationpixeldeluxeapparelcompelledhelicoptershopelessroutinelyrelaxationgravelstellabaselinebraceletdelegateexpelledmodellingeldesthelplesssquirrelnegativelyreeljewelsheltersswellingfreelanceselectionstravellersdellparcel