Skip to content

Word lists

Words With EL

7,714 words contain the letter pair EL, including well, help, feel, tell. Most common first.

Highest scoring

  • weltschmerzes32
  • zooxanthellae32
  • mozzarellas31
  • zooxanthella31
  • psychedelically31
  • sculpturesquely31
  • mozzarella30
  • exquisitely30

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first7,714

Showing the 400 most common of 7,714 words. The length links below give complete lists.

wellhelpfeeltellbelievelevelelsemyselfyourselfdevelopmentselfhimselfheldfieldlikelythemselvesrelationshipfeltmodelfeelinghellitselfrelatedreleaseelectionbelowreleasedtravelcompletelywelcomesellabsolutelyimmediatelylevelsdefinitelyhoteldevelopedtellingfeelshelpedcellfellchannelreligioussellingextremelytelevisiontellshelpingherselffellowcellsdevelopbelievedhelpslovelymodelsreligionexcellentfuelhelloelectricentirelysteelfeelingselementsintelligenceyellowselectedrelationshipsrelationselectionsdevelopingrelativelyapproximatelynovelelecteddeliveredourselvesselectionunfortunatelylargelyrelevantfieldsbelldeliveryultimatelyelpersonnelpanelreliefsurelydeliverelectronicwidelycloselywheelsmellbarelycelebrateeffectivelyrelativebeliefelementelsewhereangelselectrespectivelykellylabelhelpfulwelfarebelieveselectricitybeltrarelyelectricallatelycoloneltelephonedelayeliteshellbelongchannelsspellmerelytwelvedelicioussatelliteelementarydelreleasesrelationunlikelyshieldintellectualrelyrelaxeligiblereliablecelebritycelebrationintelligentvesselparalleltravelingangelshomelesswellslonelywheelsbeliefsshelterguidelinesneverthelessnelsonrelatetunnelbelongscelebratedexclusivelyactivelydeletehotelssafelyuselesscancelleddevelopersdevelopmentsrelatingsolelydelayedvesselswirelessdeveloperpreciselyrelativeselectronicscancelgospeldeletedbarrelbelovedcelebratingyieldmarvelcounseltravellingpreliminarywelshelderlytimelinebelievingeliminatereleasingchancellorhelicoptercrueldeltaelevenjewelryelectoralselfishbellynovelspurelyseverelygenuinelysellsdelighteddeliveringrebellabelselephantseparatelycelebritiesoverwhelmingunbelievablefreelynicelyrebelsexcellenceelderheelspanelstraveledelaboratedieseltravelsbelongingeliminatedsmellsyellingpipelinenonethelesselectchapelelevatedshelfhelmetnamelydeliberatelysellerrelaxedbelongeddelicateprivatelyspellingtelegraphaccuratelydelayssequeltravelledcompellingirrelevantdesperatelydelightbachelorfortunatelymeltwelcomedrevelationelegantelevatorhomelandrelievedtowelmodelingdelegatesrebellionshellsbattlefieldeliminationvelocitydelegationreliabilitylabeledreligionslikelihoodtelbellscanceledrelaxingelevationyieldscellulardevelopsfarewellumbrellasincerelycounselingpositivelyselectiveoverwhelmedshieldsextensivelyrelaylivelydeliversenvelopefellowshipmidfielderwheelchairyourselvescorrelationyelltimelycelebrationsgelheelelbowsellerstravelersbarrelsfuelsnickelreliedspellsfellowsrelatestunnelselectrondeliberatecollectivelymelodyreliesrelyingrelianceelephantsreluctantselectingalternativelymelpeelmeltingskeletonunrelatedbellespelledcounseloreliminatingmelteddevelopmentaljellyfelonyvelvetmaxwellrelievewheelerwelcomingdelightfulsatelliteseldersyelledcrueltyshelvesstellarcelebratescancellationlifelongremotelyrelevancetelescopeacceleratedeligibilitybeltsdwellingjewelleryappropriatelyexcelaccelerationpixeldeluxeapparelcompelledhelicoptershopelessroutinelyrelaxationgravelstellabaselinebraceletdelegateexpelledmodellingeldesthelplesssquirrelnegativelyreeljewelsheltersswellingfreelanceselectionstravellersdellparcel