Words With ET
7,375 words contain the letter pair ET, including get, something, between, better. Most common first.
Highest scoring
- plethysmography34
- methoxychlors33
- heterozygosity33
- hexachlorethane33
- methoxyfluranes33
- methylxanthines33
- methoxychlor32
- methoxyflurane32
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first7,375
Showing the 400 most common of 7,375 words. The length links below give complete lists.
getsomethingbetweenbetterletsetgettingyettogetherprettywhethermarketstreetsometimesmeetgetsreturnsocietymeetingcompletemetforgetnetworkcompletelyfeetsafetylettersecretarysecretsweetdetailscompetitionpetermetalbudgettargetreturnedmethodbetmarketingsettingcompletednetvarietysetsplanetmethodsetlettersstreetsquietdetermineddetermineupsetticketmarketsreturnsticketsteethdietdetailcompetitiveassetsbasketballretailwetsovietlettingretirementletsdetailedcabinetreturningsettlementpocketmeetingspetanxietynetworksretiredsettledconcretesheetpoetrycompetecricketlifetimeregretsettlemeetsstretchgeneticathletesveteransfleetethnicpretendjacketrockettoiletsecretspetitionjettargetsbulletassetsettingsdeletetargetedcompetingcompletioninterpretationpoetmetersveterandetectivebetaethicsmetrocarpetdeletedmetropolitantweetmetresdiabetesmagneticretainsheetssometimedeterminationwalletquietlyvegetablesclosetretreatathleticathleteeternalpatheticcompetitorsmonetaryjetsmetersetuptweetedcigarettespetspocketsdiametersocietiespettybasketbucketblanketethicalretainedaltogethercemeterydetectedcigarettedetectioncompletingpretendingdetectretiretabletplanetssketchsunsetnonethelesshelmetbulletsaesthetictweetssecretlytheoreticaloutletbettingoutletsparametersoffsetrocketstargetingprophetdeterminingdetentionballetmetalsrhetoricsyntheticvarietiesvegetablenetworkingcompetentretailersforgettinginterpretedtabletshometownsettlementsvetpetroleumdiscretionmetricgeometrystretchedbethappetitelethalmindsetbetssettlingincompletestretchingpoetsvioletbracketgeneticsresetcompetitionsmetallicathleticskilometersmarketplacemethodologynetsjacketsdetainedinterpretretentioncompetitorsympatheticpuppeteternityfletcherretiringskeletonretrievedtwentiethbulletindetachedregretssomersetretainingmetabolismvegetariansupermarketpacketvelvetdeterminesvegetationmetrebetrayednewsletternineteenthretailersettlersveterinarymetabudgetspalettesweetheartgreetretromagnetmetaphorretardedethnicityonsetpetrolninetycosmeticdetectorsketchesenergeticpenetrationpetersdietaryalphabetbraceletstretchesghettopoeticentiretyretrievebetrayalgreetingperimetertoiletsblanketscosmeticsgreetingsdetectivesproprietarydietsgreetedgeneticallyvetofetchhamletwicketsobsoletemethodistspaghettiincompetentcometretainsscarletmarketedtheoreticallyinterpretationsmethsweetsdetailingmetabolicgazetteperpetualhypotheticalfetushelmetsfetishwicketbanquetgadgetssovietsbracketsnineteensocietalgeometricaestheticstrumpetcompetenceelectromagneticsweetieparameterpretendedupsettingmetropolislettucediscreteplanetaryrepetitivemeteorpenetratedetrimentalretaliationethicbuffetkettleheadsetmethanequartetprophetstweetinginterpreterbeetlesubsetbookletsocketpacketscompletesdetectingvetsgetawaymetricsbrethrencompeteddeletingsymmetrybucketsnuggetssecretariesunforgettabledetersweetnessrepetitionretrospectiverethinkpetalsethanolketchupcabinetsdetectorsdetachmentinletgadgetbasketsdepleteddiabeticcaretakersecretariatinterpretingcompetitivenessoutsetkineticcafeteriatimetableduetpetitediscreet