Skip to content

Word lists

Words With ET

7,375 words contain the letter pair ET, including get, something, between, better. Most common first.

Highest scoring

  • plethysmography34
  • methoxychlors33
  • heterozygosity33
  • hexachlorethane33
  • methoxyfluranes33
  • methylxanthines33
  • methoxychlor32
  • methoxyflurane32

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first7,375

Showing the 400 most common of 7,375 words. The length links below give complete lists.

getsomethingbetweenbetterletsetgettingyettogetherprettywhethermarketstreetsometimesmeetgetsreturnsocietymeetingcompletemetforgetnetworkcompletelyfeetsafetylettersecretarysecretsweetdetailscompetitionpetermetalbudgettargetreturnedmethodbetmarketingsettingcompletednetvarietysetsplanetmethodsetlettersstreetsquietdetermineddetermineupsetticketmarketsreturnsticketsteethdietdetailcompetitiveassetsbasketballretailwetsovietlettingretirementletsdetailedcabinetreturningsettlementpocketmeetingspetanxietynetworksretiredsettledconcretesheetpoetrycompetecricketlifetimeregretsettlemeetsstretchgeneticathletesveteransfleetethnicpretendjacketrockettoiletsecretspetitionjettargetsbulletassetsettingsdeletetargetedcompetingcompletioninterpretationpoetmetersveterandetectivebetaethicsmetrocarpetdeletedmetropolitantweetmetresdiabetesmagneticretainsheetssometimedeterminationwalletquietlyvegetablesclosetretreatathleticathleteeternalpatheticcompetitorsmonetaryjetsmetersetuptweetedcigarettespetspocketsdiametersocietiespettybasketbucketblanketethicalretainedaltogethercemeterydetectedcigarettedetectioncompletingpretendingdetectretiretabletplanetssketchsunsetnonethelesshelmetbulletsaesthetictweetssecretlytheoreticaloutletbettingoutletsparametersoffsetrocketstargetingprophetdeterminingdetentionballetmetalsrhetoricsyntheticvarietiesvegetablenetworkingcompetentretailersforgettinginterpretedtabletshometownsettlementsvetpetroleumdiscretionmetricgeometrystretchedbethappetitelethalmindsetbetssettlingincompletestretchingpoetsvioletbracketgeneticsresetcompetitionsmetallicathleticskilometersmarketplacemethodologynetsjacketsdetainedinterpretretentioncompetitorsympatheticpuppeteternityfletcherretiringskeletonretrievedtwentiethbulletindetachedregretssomersetretainingmetabolismvegetariansupermarketpacketvelvetdeterminesvegetationmetrebetrayednewsletternineteenthretailersettlersveterinarymetabudgetspalettesweetheartgreetretromagnetmetaphorretardedethnicityonsetpetrolninetycosmeticdetectorsketchesenergeticpenetrationpetersdietaryalphabetbraceletstretchesghettopoeticentiretyretrievebetrayalgreetingperimetertoiletsblanketscosmeticsgreetingsdetectivesproprietarydietsgreetedgeneticallyvetofetchhamletwicketsobsoletemethodistspaghettiincompetentcometretainsscarletmarketedtheoreticallyinterpretationsmethsweetsdetailingmetabolicgazetteperpetualhypotheticalfetushelmetsfetishwicketbanquetgadgetssovietsbracketsnineteensocietalgeometricaestheticstrumpetcompetenceelectromagneticsweetieparameterpretendedupsettingmetropolislettucediscreteplanetaryrepetitivemeteorpenetratedetrimentalretaliationethicbuffetkettleheadsetmethanequartetprophetstweetinginterpreterbeetlesubsetbookletsocketpacketscompletesdetectingvetsgetawaymetricsbrethrencompeteddeletingsymmetrybucketsnuggetssecretariesunforgettabledetersweetnessrepetitionretrospectiverethinkpetalsethanolketchupcabinetsdetectorsdetachmentinletgadgetbasketsdepleteddiabeticcaretakersecretariatinterpretingcompetitivenessoutsetkineticcafeteriatimetableduetpetitediscreet