Words With EY
884 words contain the letter pair EY, including they, money, eyes, hey. Most common first.
Highest scoring
- conveyorization32
- conveyorizing31
- hokeypokeys30
- cockneyfying30
- conveyorized30
- hokeypokey29
- conveyorizes29
- journeyworks29
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first884
Showing the 400 most common of 884 words. The length links below give complete lists.
theymoneyeyesheykeyeyebeyondvalleysurveyattorneyjerseyjourneyturkeygreyhockeykeyshoneykeyboardmonkeybaileykidneyattorneyssurveyspreyeyedjoeyrileyabbeyalleymickeymonkeysvolleyballobeyconveywhiskeysurreyeyebrowshoneymoonsurveyedjerseysvalleysdonkeyjourneysstoreyjockeygraveyardchimneyodysseyvineyardbarleykidneyskeynotekeystonetrolleytreykeywordssmileyconveyedlangleykeyboardseyebrowsurveyorvineyardspriceyridleysurveyinghurleyeyewitnessbeypaisleykeywordmedleyconveyoreyesightlaceysmokeyparsleycharleyvolleyturkeysgalleyeyeballsconveyingconveysgreyhoundeyeingeyelidshackneyeyelinercarneyeyreeyelashesgurneyhickeyeyeballheydaymotleytourneyguernseydeyconeyalleysdonkeyswheysurveyorsobeyingobeyedbuckeyeseyelidgarveychimneyslooneyfeyleyspaceyjockeysgeybeysdeyseyaseyeneyereyneeyraeyryfleygleyleysqueysteyagleyblueybogeyboneycageycakeycooeycoseycoveycozeycuteydiceydikeydogeydopeydykeyeyerseyingeyraseyreseyrieeyrirfakeyfeyerfeylyfleysfogeygameygleysglueygooeygreyshokeyholeyhomeyhooeyjiveyjoeysjokeykeyedlimeylineylooeymameymateymopeymoseymoteymuleynoseyobeysoxeyepineypogeypokeypreysqueysrekeyropeyskieyskyeysooeytoneytreystypeywaneywaveywheyswineyabbeysbeylicbeylikbigeyeblimeyblooeyblueysbogeysboogeybugeyeburleycauseychokeyclayeyconeyscooeyscookeycoseyscoveyscozeyscrepeycrikeycurveycuteysdarkeydickeydingeydinkeydogeysdoyleydrapeyechoeyeyaseseyebareyecupeyefuleyeleteyriesfeyestflakeyfleyedflooeyflukeyfluteyfogeysgeysergleyedgooneygooseygrapeygreyedgreyergreylygripeygulleyhawkeyheydeyhoneyshonkeyhooeyshookeyhorseyjarveyjitneykerseykeyingkeypadkeysetkeywaylackeylimeyslinseylooeysmagueymameysmammeymangeymateysmoneysmooleymoseysmouseymuleysmulleymurreyobeyeroffkeyospreyoxeyesparleypeaveypeyotepeyotlphoneyphooeypinkeypogeyspokeyspoleynpreyedpreyerpulleypunkeypurveypusleyredeyerekeysrickeysawneyscareyshaleyslateyslaveysnakeyspiceyspikeystageystogeystoneytackeytawneythymeywaveyswheyeywhineywhiteywinceywitneyabeyantbaileysbaloneybarleysbeeyardbeylicsbeyliksbeyondsbigeyesblarneybogeyedboloneyboogeysbuckeyebugeyesburleyscarneyscauseyschanteychimleychooseychutneycliqueycockeyecockneycomfreycooeyedcookeyscrickeycurtseydarkeysdeadeyedickeysdiddleydingeysdinkeysdisobeydovekeydoyleyseyeableeyebarseyebeameyebolteyecupseyefulseyeholeeyehookeyelasheyelesseyeletseyelikeeyeshoteyesomeeyesoreeyespoteyewasheyeweareyewinkfeynessfisheyefleyingflunkeyfrogeyegalleysgarveysgeysersgleyinggoldeyegooneysgreyestgreyhengreyinggreyish