Skip to content

Word lists

Words With FL

2,083 words contain the letter pair FL, including floor, flight, influence, fly. Most common first.

Highest scoring

  • methoxyfluranes33
  • methoxyflurane32
  • flexography30
  • flexographic30
  • fluphenazines30
  • pasqueflowers30
  • fluphenazine29
  • pasqueflower29

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first2,083

Showing the 400 most common of 2,083 words. The length links below give complete lists.

floorflightinfluenceflyflatflyingflowflowersconflictflagflashflowerreflectfloodfleetfluidbrieflyflightsflipfleshinfluencedriflefloatingreflectionflewflowsinflationflexiblereflectedreflectsconflictsflagsfliesinfluentialflamefledinfluencesflavorfloorsflamesflowingflexibilityflourfloodingfluflorencefloatbutterflyreflectingflawsriflesflownfleeflushfletcherfloodedfloodsflatsflintfloralflagshipflexfluidsflavourinflammationflawedinflammatoryfloraflockflyersbutterfliesflashingreflectionsflippedflankflarefleeingflirtingflickconflictinginflictedflavorsflawflawlessfluffyflyerinfluxreflectivefluxflippingflopflashesflairflourishfloweringflirtflutefluentinflatedinfluenzainfluencingflapshuffleflashbackfluctuationsfloatsflashlightflatteringreflexflavoredflamingfleachieflycamouflagefloatedflushingoverflowflakesflavoursaffluentflashbacksfluorescentfleecebaffledflattenedsunflowerflashedinflictflingflungafloatflowedleafletsfleetingflourishedfleetsflaggedflopsflareswaffleselflessflipsafflictedflourishingflooringflankedflatterflushedfledgedflashyfloppyfluoridesnowflakeinflatablereflexesflatteredfluorescencewafflesoverflowingconflicteddeflectionflakeflapsflaskfluffcauliflowerraffleflossflanneldeflectflammableflanksflukeinflamedfireflybafflingflotationflaredleafletconfluencefleasflurryafflictionsnowflakesflimsyflickerfledglingflemishinflictingflicksairflowflexingdeflectedflakfluttertruffleflamingoshufflingflamboyantflaxmuffledflavouredflirtyflocksdragonflyfluencyflankingflindersfloristinflateoutflowflagrantflappingstiflereflectorfluctuatingsuperfluousfleshyfliersrefluxshuffledfluctuateflickeringflutteringflattenfloppedstiflingflatterytrufflesflackflabflamflanflayfleyflicflitflocfloeflogflubflueflusflabsflailflakyflamsflamyflansflawyflaxyflaysfleamfleckfleerfleesflewsfleysflicsfliedflierfliteflitsflocsfloesflogsflongflotafloutflubsfluedfluesflukyflumeflumpflunkfluorflutyfluytflybyflytereflyaffluxaflamebafflebarflybeflagbefleabiflexbotflycoffledayflydeaflydefleaduffleeffluxflabbyflacksflaconflaggyflagonflailsflairsflakedflakerflakeyflambeflamedflamenflamerflanesflangeflappyflasksflatlyflatusflauntflavinflaxenflaxesflayedflayerfleamsflecheflecksfleckyfledgefledgyfleechfleecyfleersflenchflensefletchfleuryflexedflexesflexorfleyedfliestflinchflingsflintsflintyflippyflirtsflitchflitedflitesfloatyflocciflockyflongsflooeyflooiefloosyfloozyfloraeflorasfloretfloridflorinflossyflotasfloursflouryfloutsfluffsflukedflukesflukeyflumedflumesflumpsflunksflunkyfluorsflutedfluterflutesfluteyfluxedfluxesfluytsflyboyflybysflymanflymenflyoffflyschflytedflytesflywaygadflyinflowlieflymayflymedflymuffleoutfly