Skip to content

Word lists

Words With FT

667 words contain the letter pair FT, including after, left, often, gift. Most common first.

Highest scoring

  • chieftainships27
  • chieftainship26
  • craftsmanships26
  • craftsmanship25
  • draftsmanships25
  • gemeinschaften25
  • handicraftsman25
  • handicraftsmen25

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first667

Showing the 400 most common of 667 words. The length links below give complete lists.

afterleftoftengiftfifthsoftwareafternoonsoftaircraftdraftshiftliftafterwardsgiftscraftfiftyswiftfifteentheftliftedliftingshiftsshiftedshiftingthereafterdraftedshaftaftermathgiftedafterwarddriftsoftlyliftsspacecraftcraftsdraftingsoftballcraftedriftleftisthalftimedraftsrooftopdriftingsofterswiftlylofttwelfthcraftinggraftraftdaftwitchcraftdriftedthriftleftoveraftkraftleftoversheftysoftenafterlifeloftyupliftingfifteenthshaftsleftistsupliftafternoonsoftleftysoftenedwarcraftcraftsmancraftyfiftiescraftsmenmakeshiftcroftniftytuftshereaftercraftsmanshipsofteningoftentimesaloftadriftrooftopsfifthsweightliftingaftermarketsiftshifterrafterssoftnessdriftsshopliftinggiftingpffthereinaftereftcoftdefteftshaftheftrefttofttuftwaftweftabaftcleftcliftdelftgrifthaftsheftsleftsloftsmuftiofterraftsriftssiftssoftasoftssoftytoftstuftywaftsweftswiftyaftersaftosabereftcaftancleftscliftscroftsdafterdaftlydefterdeftlydelftsdraftydriftygraftsgriftshaftedhafterheftedhefterkaftankraftslefterlifterloftedloftermaftirmuftisoftestraftedrafterresiftriftedshiftyshriftsiftedsiftersoftassoftieswiftstheftstuftedtufterupwaftwaftedwafterzaftigzoftigaftmostaftosasairliftcaftanscleftedcrofterdaftestdeftestdrafteedrafterdriftereftsoonengraftfifthlygraftedgraftergriftedgrifterhaftarahaftershaftinghayloftheftersheftierheftilyheftingindraftingraftkaftansleftestleftiesleftishleftismliftersliftmanliftmenliftoffloftersloftierloftilyloftingmaftirsniftierniftiesniftilyoftenerpooftahpoofterpresiftraftingredraftregraftresiftsriftingshaftedshriftssifterssiftingsniftersoftenssoftestsoftiessoftishswifterthriftsthriftytufterstuftiertuftilytuftingunshiftupdraftupliftsupshiftupwaftswaftagewafterswaftingwafturewiftieraftertaxairliftsantileftcamshaftcleftingcockloftcraftiercraftilycroftersdaftnessdeadliftdeftnessdrafteesdraftersdraftierdraftilydriftagedriftersdriftierdriftpineftsoonsengraftsfifteensfiftiethfiftyishforkliftgiftedlygiftlessgiftwaregraftagegraftersgraftinggriftersgriftinghaftarahhaftarashaftarothaftorahhaftorothalftonehayloftsheftiestheliliftindraftsingraftsisograftleftismsleftwardleftwingliftableliftgateliftoffsloftiestloftlessloftlikemisgraftniftiestofftrackoftenestofttimesoversoftpooftahspoofterspresiftsrafteredraftsmanraftsmenredraftsredshiftregraftsresiftedriftlessrooftreeseacraftsemisoftshaftingshiftersshiftiershiftilyshopliftsiftingssnifterssoftbacksoftenersoftheadsoftwoodsubshaftswiftersswiftestswiftlettoploftytuftiesttwelfthsungiftedunshiftsunsifteduntuftedupdraftsuplifteduplifterupshiftsupwaftedwaftageswafturesweftwisewiftiestaftercareafterclapafterdeckafterglowaftermostaftertimeafterwordairliftedallograftantidraftantitheftautograftblueshiftcampcraftcamshaftscandytuftchairliftchieftaincockloftscraftiestdeadliftsdelftwaredowndraftdownshiftdraftabledraftiestdraftingsdraftsmandraftsmendriftagesdriftiestdriftpinsdriftwood