Words With FT
667 words contain the letter pair FT, including after, left, often, gift. Most common first.
Highest scoring
- chieftainships27
- chieftainship26
- craftsmanships26
- craftsmanship25
- draftsmanships25
- gemeinschaften25
- handicraftsman25
- handicraftsmen25
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first667
Showing the 400 most common of 667 words. The length links below give complete lists.
afterleftoftengiftfifthsoftwareafternoonsoftaircraftdraftshiftliftafterwardsgiftscraftfiftyswiftfifteentheftliftedliftingshiftsshiftedshiftingthereafterdraftedshaftaftermathgiftedafterwarddriftsoftlyliftsspacecraftcraftsdraftingsoftballcraftedriftleftisthalftimedraftsrooftopdriftingsofterswiftlylofttwelfthcraftinggraftraftdaftwitchcraftdriftedthriftleftoveraftkraftleftoversheftysoftenafterlifeloftyupliftingfifteenthshaftsleftistsupliftafternoonsoftleftysoftenedwarcraftcraftsmancraftyfiftiescraftsmenmakeshiftcroftniftytuftshereaftercraftsmanshipsofteningoftentimesaloftadriftrooftopsfifthsweightliftingaftermarketsiftshifterrafterssoftnessdriftsshopliftinggiftingpffthereinaftereftcoftdefteftshaftheftrefttofttuftwaftweftabaftcleftcliftdelftgrifthaftsheftsleftsloftsmuftiofterraftsriftssiftssoftasoftssoftytoftstuftywaftsweftswiftyaftersaftosabereftcaftancleftscliftscroftsdafterdaftlydefterdeftlydelftsdraftydriftygraftsgriftshaftedhafterheftedhefterkaftankraftslefterlifterloftedloftermaftirmuftisoftestraftedrafterresiftriftedshiftyshriftsiftedsiftersoftassoftieswiftstheftstuftedtufterupwaftwaftedwafterzaftigzoftigaftmostaftosasairliftcaftanscleftedcrofterdaftestdeftestdrafteedrafterdriftereftsoonengraftfifthlygraftedgraftergriftedgrifterhaftarahaftershaftinghayloftheftersheftierheftilyheftingindraftingraftkaftansleftestleftiesleftishleftismliftersliftmanliftmenliftoffloftersloftierloftilyloftingmaftirsniftierniftiesniftilyoftenerpooftahpoofterpresiftraftingredraftregraftresiftsriftingshaftedshriftssifterssiftingsniftersoftenssoftestsoftiessoftishswifterthriftsthriftytufterstuftiertuftilytuftingunshiftupdraftupliftsupshiftupwaftswaftagewafterswaftingwafturewiftieraftertaxairliftsantileftcamshaftcleftingcockloftcraftiercraftilycroftersdaftnessdeadliftdeftnessdrafteesdraftersdraftierdraftilydriftagedriftersdriftierdriftpineftsoonsengraftsfifteensfiftiethfiftyishforkliftgiftedlygiftlessgiftwaregraftagegraftersgraftinggriftersgriftinghaftarahhaftarashaftarothaftorahhaftorothalftonehayloftsheftiestheliliftindraftsingraftsisograftleftismsleftwardleftwingliftableliftgateliftoffsloftiestloftlessloftlikemisgraftniftiestofftrackoftenestofttimesoversoftpooftahspoofterspresiftsrafteredraftsmanraftsmenredraftsredshiftregraftsresiftedriftlessrooftreeseacraftsemisoftshaftingshiftersshiftiershiftilyshopliftsiftingssnifterssoftbacksoftenersoftheadsoftwoodsubshaftswiftersswiftestswiftlettoploftytuftiesttwelfthsungiftedunshiftsunsifteduntuftedupdraftsuplifteduplifterupshiftsupwaftedwaftageswafturesweftwisewiftiestaftercareafterclapafterdeckafterglowaftermostaftertimeafterwordairliftedallograftantidraftantitheftautograftblueshiftcampcraftcamshaftscandytuftchairliftchieftaincockloftscraftiestdeadliftsdelftwaredowndraftdownshiftdraftabledraftiestdraftingsdraftsmandraftsmendriftagesdriftiestdriftpinsdriftwood