Words With HI
5,397 words contain the letter pair HI, including this, his, which, him. Most common first.
Highest scoring
- whizzbangs37
- whizzbang36
- schizophrenics35
- huzzahing34
- schizophrenic34
- philosophizing34
- schizzy33
- whizzing33
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first5,397
Showing the 400 most common of 5,397 words. The length links below give complete lists.
thishiswhichhimthinkwhilesomethinghighthingsthingnothinganythingeverythingwhiteshitchildrenwithinhistoryhitthirdchildbehindhimselfthinkinghigherrelationshipchiefchinawatchinghishipmachinehighlyhighesthillfashionthinksleadershipvehicleteachinghistoricalrelationshipshitsshirtchickenvehicleslaughingshiftachieveshipshidechampionshiphiddenshippingchildhoodhighwayachievedhistoricphilosophymeanwhilepartnershipthinfishingbullshitclothingmembershiphiphillsthickhittingmachinesreachingpushingarchitecturehiredhireownershipfriendshipthirtywhilstexhibitionpublishingsearchingachievementhidingchipshieldfinishingworshipcoachingfranchisebreathinghighlightshilarioushiringgraphicshirtstouchingchipshighlightcatchingethicsgraphicschillshineapproachingexhibitsunshinescholarshipwashingestablishingarchivesmatchingcitizenshipchickarchitecthistoricallyhintchiefsethicalchilewhitesswitchingachievementssophisticatedshittyshippedachievingchampionshipsmachinerywhipshiftschinlaunchingprohibitedarchiveshiftedshiningshiftingtownshipgeographicarchitecturalchihikerushingphilosophicalwishingfashioneddemographicthirdsarchitectshistorianawhilethirteenhighlightedshinythiefwhistledolphinshighwayschickshikingshieldspsychiatricexhibitedfellowshiphintscensorshipstretchinggeographicalcrashingweighingthievescrushingrefreshingchickensexhibitsmarchinghistorianspartnershipshealthierpsychichidhipsgrandchildrenwhiskeyhierarchyprohibitionshipmentteachingsphotographicscholarshipsflagshippitchingthicknessthirstywhisperworthwhilechilithighchildishphilosophersponsorshipwhippedhighlandhistorieswhicheverpsychiatristshinhideschillingpreachingchicsushibathingflashingexhibitionsthighsdolphinpunchingtrophiesastonishingfriendshipshighlightingdownhillsmashinggothichighlandsfashionableshitsthirstshipmentsdictatorshipwhiskyresearchingphilosophersinternshippremiershipshinesthickerhighscushioncatastrophichicksrhinocashierwhisperslithiumthinnerhardshipfranchisespsychiatryscratchingdemographicsschizophreniaphichimneywhiningethicprohibithindhivechillyhitterbrushingpunishinghiatuschilledhiresthinkersshirerethinkapprenticeshipcoughinggraphicalbashinghideoussoothingmythicalsapphirewhisperedhitchchillschieflyprohibitschildbirthdealershipinhibitorsprehistoricwhisperingwindshieldhintedarchivedflushingshittingexhibitinghinderthinkerinhibitionuphillhillsideinhibitordiminishingbiographicalitchingmorphinehippiemischiefwhippinganarchistspaceshipthirteenthhipstergraphitedistinguishinggeographicallyhikeshingesinhibithighnesshindsightshivaachieveshardshipsarchipelagoshipbuildinghingefurnishingsprohibitingphilanthropythinewhistlesunethicalorchidwarshipspedophileachingchillihijackedlordshipwealthiestflourishingwhimwhinearchivalpolishingworshippedthinlydashingshipyardvanishingunthinkablesophisticationstarshipattachinginternshipshierarchicalpsychiatristschippedsmoothiemembershipshittersthistlethirtiesbranchingwhirlwindshieldingtownshipssympathiesbiographiesphilosophiesaccomplishingwhifffashionsstewardshipannihilationchicohinderedchihuahuawhistlingachievablephilanthropicshieldedwhipsbitchingcushionscourtshipsweatshirtphilharmoniccompanionshipphotographingrhinosmakeshifthandkerchiefpornographicwhistleblowerhillyshillingclutchinganarchists