Skip to content

Word lists

Words With HI

5,397 words contain the letter pair HI, including this, his, which, him. Most common first.

Highest scoring

  • whizzbangs37
  • whizzbang36
  • schizophrenics35
  • huzzahing34
  • schizophrenic34
  • philosophizing34
  • schizzy33
  • whizzing33

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first5,397

Showing the 400 most common of 5,397 words. The length links below give complete lists.

thishiswhichhimthinkwhilesomethinghighthingsthingnothinganythingeverythingwhiteshitchildrenwithinhistoryhitthirdchildbehindhimselfthinkinghigherrelationshipchiefchinawatchinghishipmachinehighlyhighesthillfashionthinksleadershipvehicleteachinghistoricalrelationshipshitsshirtchickenvehicleslaughingshiftachieveshipshidechampionshiphiddenshippingchildhoodhighwayachievedhistoricphilosophymeanwhilepartnershipthinfishingbullshitclothingmembershiphiphillsthickhittingmachinesreachingpushingarchitecturehiredhireownershipfriendshipthirtywhilstexhibitionpublishingsearchingachievementhidingchipshieldfinishingworshipcoachingfranchisebreathinghighlightshilarioushiringgraphicshirtstouchingchipshighlightcatchingethicsgraphicschillshineapproachingexhibitsunshinescholarshipwashingestablishingarchivesmatchingcitizenshipchickarchitecthistoricallyhintchiefsethicalchilewhitesswitchingachievementssophisticatedshittyshippedachievingchampionshipsmachinerywhipshiftschinlaunchingprohibitedarchiveshiftedshiningshiftingtownshipgeographicarchitecturalchihikerushingphilosophicalwishingfashioneddemographicthirdsarchitectshistorianawhilethirteenhighlightedshinythiefwhistledolphinshighwayschickshikingshieldspsychiatricexhibitedfellowshiphintscensorshipstretchinggeographicalcrashingweighingthievescrushingrefreshingchickensexhibitsmarchinghistorianspartnershipshealthierpsychichidhipsgrandchildrenwhiskeyhierarchyprohibitionshipmentteachingsphotographicscholarshipsflagshippitchingthicknessthirstywhisperworthwhilechilithighchildishphilosophersponsorshipwhippedhighlandhistorieswhicheverpsychiatristshinhideschillingpreachingchicsushibathingflashingexhibitionsthighsdolphinpunchingtrophiesastonishingfriendshipshighlightingdownhillsmashinggothichighlandsfashionableshitsthirstshipmentsdictatorshipwhiskyresearchingphilosophersinternshippremiershipshinesthickerhighscushioncatastrophichicksrhinocashierwhisperslithiumthinnerhardshipfranchisespsychiatryscratchingdemographicsschizophreniaphichimneywhiningethicprohibithindhivechillyhitterbrushingpunishinghiatuschilledhiresthinkersshirerethinkapprenticeshipcoughinggraphicalbashinghideoussoothingmythicalsapphirewhisperedhitchchillschieflyprohibitschildbirthdealershipinhibitorsprehistoricwhisperingwindshieldhintedarchivedflushingshittingexhibitinghinderthinkerinhibitionuphillhillsideinhibitordiminishingbiographicalitchingmorphinehippiemischiefwhippinganarchistspaceshipthirteenthhipstergraphitedistinguishinggeographicallyhikeshingesinhibithighnesshindsightshivaachieveshardshipsarchipelagoshipbuildinghingefurnishingsprohibitingphilanthropythinewhistlesunethicalorchidwarshipspedophileachingchillihijackedlordshipwealthiestflourishingwhimwhinearchivalpolishingworshippedthinlydashingshipyardvanishingunthinkablesophisticationstarshipattachinginternshipshierarchicalpsychiatristschippedsmoothiemembershipshittersthistlethirtiesbranchingwhirlwindshieldingtownshipssympathiesbiographiesphilosophiesaccomplishingwhifffashionsstewardshipannihilationchicohinderedchihuahuawhistlingachievablephilanthropicshieldedwhipsbitchingcushionscourtshipsweatshirtphilharmoniccompanionshipphotographingrhinosmakeshifthandkerchiefpornographicwhistleblowerhillyshillingclutchinganarchists