Skip to content

Word lists

Words With HL

586 words contain the letter pair HL, including highly, monthly, roughly, athletes. Most common first.

Highest scoring

  • hexachlorophene35
  • methoxychlors33
  • chlorothiazides33
  • chlorpromazines33
  • hexachlorethane33
  • methoxychlor32
  • chlorothiazide32
  • chlorpromazine32

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first586

Showing the 400 most common of 586 words. The length links below give complete lists.

highlymonthlyroughlyathleteshighlightshighlightathleticathletethoroughlyhighlightedathleticsworthlesshighlandsmoothlyhighlightingruthlesshighlandsfreshlyflashlightchlorinechlorideearthlypamphletrichlyharshlyspeechlesstriathlonpamphletsbreathlessdahlhighlandersathleticismfoolishlytoothlessbuhlkohlbuhlsdahlskohlsmuhlyphloxshlepuhlanarchlyashlarashlerdahlialushlymuchlyphlegmphloemposhlyrashlyschlepshleppshlepsshlockshlumpuhlansapishlyashlarsashlersashlessbashlykbrashlychlamyschloralchloricchloridchlorincichlidcochleadahliasdeathlyfifthlyfleshlylaithlyloathlymuhliesninthlypahlaviphlegmsphlegmyphloemsphloxesplushlyschleppschlepsschlockschlumpshleppsshlocksshlumpsshlumpysixthlysoothlyswithlytenthlyteughlytoughlytrachleaguishlyashlaredashleredbashlyksbathlessbiathlonboyishlybuhlworkbushlandbushlessbushlikecashlesschloasmachloralschloratechlordanchloridschlorinschloritechlorouschurchlycichlidscochleaecochlearcochleasdishlikedudishlyeighthlyelfishlyelvishlyfahlbandfishlessfishlikefishlinefourthlygarishlyhighlifeimpishlyjadishlykohlrabilavishlymodishlymopishlymothlikemulishlynathlessoafishlyoffishlyogrishlyowlishlypahlavispathlesspenuchlepinochlepithlesspopishlyrakishlyrashlikeroughlegrushlikeschleppsschliereschlocksschlockyschlumpsshashlikshlemielshleppedshlumpedsighlesssighlikestanchlysuchliketonishlytrachledtrachlestrauchletrochleauppishlywishlessashlaringashleringbeamishlybearishlybenchlandbiathletebiathlonsbimonthlybookishlyboorishlybranchletbrushlandbrutishlybuhlworksbullishlybushlandscaddishlychlamydeschlamydiachlamyseschloracnechlorateschlordanechlordanschlorellachlorideschlorineschloriteschloriticchloroseschlorosischloroticcichlidaecoltishlycultishlycurrishlydeathlessdecathlondepthlessdoggishlydollishlydoltishlydonnishlydoughlikedullishlyearthlierearthlikeearthlingfahlbandsfairishlyfaithlessfishlinesflashlampfleshlierfoppishlygawkishlygirlishlyhatchlinghawkishlyheathlandheathlessheathlikehellishlyhighlifeshoggishlyknavishlyleechlikeloutishlylumpishlymahlstickmannishlymarchlikemarshlandmatchlessmatchlockmawkishlymirthlessmonthliesmonthlongmoonishlymouthlikenorthlandochlocratpeevishlypenuchlespettishlyphlebitisphlegmierpiggishlypinochlesprudishlypuckishlypunchlessraffishlyroguishlyroughlegsrushlightruttishlyschlemielschleppedschlierenschliericschlumpedselfishlyshashlickshashliksshlemiehlshlemielsshleppingshlumpingsickishlyslavishlysottishlysouthlandstaunchlystylishlyswinishlysylphlikethroughlytoothliketouchlinetrachlingtrauchledtrauchlestrochleaetrochleartrochleasuncouthlyunearthlyvetchlingwaggishlywaspishlywitchlikewolfishlybenchlandsbiathletesblimpishlybranchlessbranchletsbranchlinebrushlandscheapishlychildishlychlamydiaechlamydialchloasmatachloracneschloralosechloraminechlordaneschlorellaschlorinatechlorinitychloroformchurchlesschurchlierchurlishlyclannishlycliquishlyclownishlydandyishlydecathletedecathlonsdevilishlydichlorvosdwarfishlyearthliestearthlightearthlingsfeverishlyfiendishlyflashlampsfleshliestfreakishlyghoulishlyhatchlingsheathlandsheptachlorhighlanderkohlrabiesmahlsticksmarshlandsmatchlocksnonathletenorthlandsochlocracyochlocratspentathlonphlebogramphlebologyphlebotomyphlegmaticphlegmiestphlogisticphlogistonphlogopiteprankishlypriggishlyqualmishlyquenchlessrushlightsruthlesslyschlemielsschleppingschlumpingsearchlessshashlickssheepishlyshlemiehlsshrewishlyskittishlysluggishlysluttishlysnappishlysniffishlysnobbishlysouthlandssquarishlysweetishly