Skip to content

Word lists

Words With IL

7,180 words contain the letter pair IL, including will, still, while, family. Most common first.

Highest scoring

  • hypercivilized37
  • hypnotizability37
  • ventriloquizing37
  • squeezability36
  • ventriloquized36
  • jazzily35
  • ventriloquizes35
  • squeezabilities35

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first7,180

Showing the 400 most common of 7,180 words. The length links below give complete lists.

willstillwhilefamilyuntilchildrenmillionchildbuildingavailablekilledsimilarfilmmilitarybilloilkillcouncilbuiltdailybuildmilesabilityfamiliescivileasilydetailskillingmobilehillfailedprofilevillagesilverwildtillskillsfilebillionresponsibilityevilillmailfailurewillingfilledbuildingsillegalmilkfacilitiesfillfilmssmilemillionsjailfailguiltyfamiliarfacilitymilebrazilpossibilitydetailretailbrilliantheavilybillspilotdetailedchildhoodmillerfiledphilosophymeanwhileprimarilynecessarilykillerfileshillsrailwaysilencetrailsilentsoilskillrailillnesssillymillwhilsttailkillsbillywildlifetrailerrailroadtoiletstabilitydevilfailingsimilarlyfilterutilityhilariousfailscivilianmillsnailabilitiesdisabilityvillaprivilegefillingfilmingchillpupilsceilingvillagesillustratedsurveillanceliabilitysmilingpilemissileguiltskilledavailabilitypilotsmildsilkhappilycapabilitiespossibilitiesciviliansdrillhostilecapabilitychilebaileyfilmedtemporarilypillsfilingmobilitynailstilpillflexibilityprobabilitybailsailcivilizationsiliconfossilsailingfailuresaffiliatefacilitaterehabilitationcompiledbillionspillowartilleryaffiliatedlilybuildspencilmissileswildernessphilosophicalcouncilsillusionthrilledautomobileguildreadilydrillinginabilitydisabilitieshailtrailsluckilyretailersreliabilityillustrationsmileskillersthrilleraccountabilityrileygilbertrebuildawhilecocktailprofilesutilitiesmanilafiltersmilitiavillainjuvenilecredibilitybillboardillegallyillustrationsoilssmiledfragilefulfilltrilogybuilderrailwayscompilationexilegrillspillvanillasteadilyboilutilizedtwilightkilometerswillingnessjillpupilspoilspoiledprivilegedfilthybuildersrailsdevilstrillionsimilaritiesgrandchildrenbodilysailorfertilityvisibilitysilvanailedfulfilledsustainabilityfoilunveiledprivilegesbillionaireboilingsailorstextileutilizeretailervillagerseligibilitymilauxiliaryworthwhilecoilchilidilemmachildishmillionairetilethrillvolatilebilateralphilosophervoluntarilyreconciliationfillstilesboilersailedwildlygrilledmilestonefulfillingillustraterebuildinginstabilityunwillingmillenniumvulnerabilitywillowchillingkillingscouncillortailsboiledsnailtoiletsgoodwillillnessestiltveildownhillversatilebasiltrailersvillainspillarmileagegillspilledutilizingaffiliationillustratesunavailablevilemailsfertilegorillapillarsrebuiltmilitantpaviliondetailingfilmmakerunfamiliarphilosopherswillswillytailorhostilitythrillingmailingcocktailsaffiliatesequilibriumventilationavailpilesbilleddrillsjailedbillinghumilitycompatibilitysilentlywillinglyresiliencesimilaritysoilsmilosheilatailoredfilteringmilitantsliabilitiesfulfilprevailspoilertrailingprevailinghumiliationfossilssailsturmoilbilingualcivilizeddrilledfiltereddiligencefilmmakerscouncillorsaccessibilitymilkychillymailedpillowsreconcileresilientpilgrimageilluminatedutilizationprofitabilityhailedchilledtextilescrocodilevolatilityautomobilestequilapilgrimsfacilitateddilutednobilityrailroadsgrailbillieepilepsyspoilersstabilizebrilliantlyhumiliatingillustratorceilingsdurabilityvillasjubilee