Words With IL
7,180 words contain the letter pair IL, including will, still, while, family. Most common first.
Highest scoring
- hypercivilized37
- hypnotizability37
- ventriloquizing37
- squeezability36
- ventriloquized36
- jazzily35
- ventriloquizes35
- squeezabilities35
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first7,180
Showing the 400 most common of 7,180 words. The length links below give complete lists.
willstillwhilefamilyuntilchildrenmillionchildbuildingavailablekilledsimilarfilmmilitarybilloilkillcouncilbuiltdailybuildmilesabilityfamiliescivileasilydetailskillingmobilehillfailedprofilevillagesilverwildtillskillsfilebillionresponsibilityevilillmailfailurewillingfilledbuildingsillegalmilkfacilitiesfillfilmssmilemillionsjailfailguiltyfamiliarfacilitymilebrazilpossibilitydetailretailbrilliantheavilybillspilotdetailedchildhoodmillerfiledphilosophymeanwhileprimarilynecessarilykillerfileshillsrailwaysilencetrailsilentsoilskillrailillnesssillymillwhilsttailkillsbillywildlifetrailerrailroadtoiletstabilitydevilfailingsimilarlyfilterutilityhilariousfailscivilianmillsnailabilitiesdisabilityvillaprivilegefillingfilmingchillpupilsceilingvillagesillustratedsurveillanceliabilitysmilingpilemissileguiltskilledavailabilitypilotsmildsilkhappilycapabilitiespossibilitiesciviliansdrillhostilecapabilitychilebaileyfilmedtemporarilypillsfilingmobilitynailstilpillflexibilityprobabilitybailsailcivilizationsiliconfossilsailingfailuresaffiliatefacilitaterehabilitationcompiledbillionspillowartilleryaffiliatedlilybuildspencilmissileswildernessphilosophicalcouncilsillusionthrilledautomobileguildreadilydrillinginabilitydisabilitieshailtrailsluckilyretailersreliabilityillustrationsmileskillersthrilleraccountabilityrileygilbertrebuildawhilecocktailprofilesutilitiesmanilafiltersmilitiavillainjuvenilecredibilitybillboardillegallyillustrationsoilssmiledfragilefulfilltrilogybuilderrailwayscompilationexilegrillspillvanillasteadilyboilutilizedtwilightkilometerswillingnessjillpupilspoilspoiledprivilegedfilthybuildersrailsdevilstrillionsimilaritiesgrandchildrenbodilysailorfertilityvisibilitysilvanailedfulfilledsustainabilityfoilunveiledprivilegesbillionaireboilingsailorstextileutilizeretailervillagerseligibilitymilauxiliaryworthwhilecoilchilidilemmachildishmillionairetilethrillvolatilebilateralphilosophervoluntarilyreconciliationfillstilesboilersailedwildlygrilledmilestonefulfillingillustraterebuildinginstabilityunwillingmillenniumvulnerabilitywillowchillingkillingscouncillortailsboiledsnailtoiletsgoodwillillnessestiltveildownhillversatilebasiltrailersvillainspillarmileagegillspilledutilizingaffiliationillustratesunavailablevilemailsfertilegorillapillarsrebuiltmilitantpaviliondetailingfilmmakerunfamiliarphilosopherswillswillytailorhostilitythrillingmailingcocktailsaffiliatesequilibriumventilationavailpilesbilleddrillsjailedbillinghumilitycompatibilitysilentlywillinglyresiliencesimilaritysoilsmilosheilatailoredfilteringmilitantsliabilitiesfulfilprevailspoilertrailingprevailinghumiliationfossilssailsturmoilbilingualcivilizeddrilledfiltereddiligencefilmmakerscouncillorsaccessibilitymilkychillymailedpillowsreconcileresilientpilgrimageilluminatedutilizationprofitabilityhailedchilledtextilescrocodilevolatilityautomobilestequilapilgrimsfacilitateddilutednobilityrailroadsgrailbillieepilepsyspoilersstabilizebrilliantlyhumiliatingillustratorceilingsdurabilityvillasjubilee