Skip to content

Word lists

Words With LA

9,976 words contain the letter pair LA, including last, place, play, later. Most common first.

Highest scoring

  • cyclohexylamine37
  • hyperpolarizing35
  • blackjacking34
  • hyperpolarized34
  • hydroxylapatite34
  • kaffeeklatsches34
  • blackjacked33
  • hydroxylamines33

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first9,976

Showing the 400 most common of 9,976 words. The length links below give complete lists.

lastplaceplaylaterlawblacklargeplayingclasslateplayersplanavailableplayedlandsimilarplayerrelationshiprelatedlanguagepopularlaplacesplansislandpopulationparticularparticularlyladyclaimregularlacklatestgladlargestplanninglawsplantexplainclaimsglassplacedplayslakelargervillagedollarslaborclassesbalanceflatplaneclassicplantslabourlaunchplannedplanetrelationshipslawyerplatformrelationslaughrelativelylayladiesclaimedblamedisplaylaunchedlargelylaughingdollarexplainedflagreplacelanelaidlatterplatedeclaredreplacedlegislationsolarregularlyplasticislandsregulationschocolaterelativealanflashpalaceformulaexplanationreplacementlabelplainlabexplainslanguageslatelydelaylayerlandingcongratulationslawyerstranslationregulationlandssalarylandscapeglassesclaimingblastcomplaintlegislativeslaverelationlaboratorysimilarlyclayrelaxlasalarmgalaxycollaborationhilariousclassicalclassifiedlazylauralandedrelatelaughedisolatedpopularitylaptopcomplaincomplaintsexplainingregulatoryplatesslaveryplayoffsrelatinglaservilladelayedrelativesbladealaskaslavesplatformspopulationslapbalancedcollapsedisplayedclassificationlayersplacingvillagessurveillancelayingplaneslegislatureinstallationsaladblacksclassroomreplacingviolationtranslatedscholarshipblanklakesinflationplayoffavailabilityscholarscomplaininglastingmolecularhollandlaughtercalculateddeclarationflagslastedlawsuitlabelslaughslayoutlackingflameblanketdisplayslaundryambulanceelaboratespectacularlampdeclareplanetscollarflavorplantedplacementworkplaceflamesladderpeninsulalambslamplatinumisolationrelaxedclauselaunchingcomplainedviolationsspeculationlawndelaysregulatedclanslapclashlanespolarscholarcircularrevelationcirculationlameplasmasecularhomelandmainlandlancesimulationtranslateairplanecollapsedplazaglancelabeledviolatedladlastsblamedlakersclarityclassicsrelaxinglacksplagueplainscellularlandlordlandmarklaunchessalariesumbrellablahmanilablamingvillainbladesregulatecalculatecalculationsladsrelaycorrelationlangflawssplashclarifynecklacecompilationmanipulationvanillaslaughterinlandapplauselabslaceslatereplayrelatesdeclaringvocabularymarketplaceplantingatlaslackedbalancingdisplacedunrelatedlatinopopulatedplaygroundsimilaritiescollaborativeinstallationsflatsteslaproclaimedstellartransplantcalculationcancellationexplanationsscholarshipslateralviolateflagshipvillagerscolaladensingularlavalampsflavourlambertviolatinginflammationclassyflawedunlawfulvolatilebilateralunpopularlandscapesplantationsunglassesinflammatorylaboratoriestranslationsslackclarencedeclarestemplaterelaxationstellaoverlaphighlandacclaimedirregularaccumulatedstimulationblazelastlyplaquemidlandsmanipulateflashingfreelancedisplayingcardiovascularlagalasgalalaysgladlyslappedblanketsmuscularstimulateclassroomsinsulationtranslatestranslatorlapsbacklashcollateralslashmalariavillainswoodlandhighlandsblackberrylegislatorsflankflarepillarplausibleclassmatesmultiplayerslamslaurellawsuitsreplacesunavailabledisplacementlawfulbipolarbladder