Words With LA
9,976 words contain the letter pair LA, including last, place, play, later. Most common first.
Highest scoring
- cyclohexylamine37
- hyperpolarizing35
- blackjacking34
- hyperpolarized34
- hydroxylapatite34
- kaffeeklatsches34
- blackjacked33
- hydroxylamines33
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first9,976
Showing the 400 most common of 9,976 words. The length links below give complete lists.
lastplaceplaylaterlawblacklargeplayingclasslateplayersplanavailableplayedlandsimilarplayerrelationshiprelatedlanguagepopularlaplacesplansislandpopulationparticularparticularlyladyclaimregularlacklatestgladlargestplanninglawsplantexplainclaimsglassplacedplayslakelargervillagedollarslaborclassesbalanceflatplaneclassicplantslabourlaunchplannedplanetrelationshipslawyerplatformrelationslaughrelativelylayladiesclaimedblamedisplaylaunchedlargelylaughingdollarexplainedflagreplacelanelaidlatterplatedeclaredreplacedlegislationsolarregularlyplasticislandsregulationschocolaterelativealanflashpalaceformulaexplanationreplacementlabelplainlabexplainslanguageslatelydelaylayerlandingcongratulationslawyerstranslationregulationlandssalarylandscapeglassesclaimingblastcomplaintlegislativeslaverelationlaboratorysimilarlyclayrelaxlasalarmgalaxycollaborationhilariousclassicalclassifiedlazylauralandedrelatelaughedisolatedpopularitylaptopcomplaincomplaintsexplainingregulatoryplatesslaveryplayoffsrelatinglaservilladelayedrelativesbladealaskaslavesplatformspopulationslapbalancedcollapsedisplayedclassificationlayersplacingvillagessurveillancelayingplaneslegislatureinstallationsaladblacksclassroomreplacingviolationtranslatedscholarshipblanklakesinflationplayoffavailabilityscholarscomplaininglastingmolecularhollandlaughtercalculateddeclarationflagslastedlawsuitlabelslaughslayoutlackingflameblanketdisplayslaundryambulanceelaboratespectacularlampdeclareplanetscollarflavorplantedplacementworkplaceflamesladderpeninsulalambslamplatinumisolationrelaxedclauselaunchingcomplainedviolationsspeculationlawndelaysregulatedclanslapclashlanespolarscholarcircularrevelationcirculationlameplasmasecularhomelandmainlandlancesimulationtranslateairplanecollapsedplazaglancelabeledviolatedladlastsblamedlakersclarityclassicsrelaxinglacksplagueplainscellularlandlordlandmarklaunchessalariesumbrellablahmanilablamingvillainbladesregulatecalculatecalculationsladsrelaycorrelationlangflawssplashclarifynecklacecompilationmanipulationvanillaslaughterinlandapplauselabslaceslatereplayrelatesdeclaringvocabularymarketplaceplantingatlaslackedbalancingdisplacedunrelatedlatinopopulatedplaygroundsimilaritiescollaborativeinstallationsflatsteslaproclaimedstellartransplantcalculationcancellationexplanationsscholarshipslateralviolateflagshipvillagerscolaladensingularlavalampsflavourlambertviolatinginflammationclassyflawedunlawfulvolatilebilateralunpopularlandscapesplantationsunglassesinflammatorylaboratoriestranslationsslackclarencedeclarestemplaterelaxationstellaoverlaphighlandacclaimedirregularaccumulatedstimulationblazelastlyplaquemidlandsmanipulateflashingfreelancedisplayingcardiovascularlagalasgalalaysgladlyslappedblanketsmuscularstimulateclassroomsinsulationtranslatestranslatorlapsbacklashcollateralslashmalariavillainswoodlandhighlandsblackberrylegislatorsflankflarepillarplausibleclassmatesmultiplayerslamslaurellawsuitsreplacesunavailabledisplacementlawfulbipolarbladder