Words With LY
7,268 words contain the letter pair LY, including only, really, family, actually. Most common first.
Highest scoring
- quizzically43
- psychoanalyzing38
- psychoanalyzed37
- dizzyingly36
- psychoanalyzes36
- coenzymatically36
- jazzily35
- psychoanalyze35
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first7,268
Showing the 400 most common of 7,268 words. The length links below give complete lists.
onlyreallyfamilyactuallyearlyprobablyespeciallylikelyfinallyexactlyusuallysimplycurrentlydailyrecentlynearlyquicklycertainlycompletelyabsolutelyimmediatelydefinitelyparticularlygenerallyseriouslyclearlyeasilyanalysisliterallydirectlyfullyhighlyholyeventuallytrulymostlytotallypreviouslyapplysupplyobviouslyapparentlyextremelypossiblyflyslightlylovelyentirelyflyinghonestlysuddenlyoriginallylyingrelativelyspecificallyfriendlyproperlyapproximatelyslowlybasicallytypicallyunfortunatelylargelyassemblyperfectlymainlyweeklynormallypersonallyultimatelyhopefullyfrequentlysurelywidelyheavilysignificantlyhardlycloselyconstantlyofficiallyregularlyautomaticallyreplyfairlymonthlybarelyinitiallyeffectivelynaturallyprimarilynecessarilyshortlystronglycarefullyrespectivelysuccessfullybadlykellydeeplyuglynewlyrarelyessentiallylatelysillyequallypotentiallyoccasionallycommonlyincrediblyincreasinglymerelyroughlylyricsrallyrapidlybillygreatlyunlikelypartlysimilarlyphysicallyrelypubliclyvirtuallylonelyapplyingformerlyexclusivelyconsistentlyactivelyinstantlydifferentlysubsequentlysafelybrieflyaccidentallylegallycorrectlygraduallyrepeatedlysolelymentallypreciselyadditionallypartiallypracticallysadlyunderlyingsimultaneouslydeadlyannuallystrictlyelderlyquietlysexuallyreportedlyopenlyhappilylocallyallybellypoorlypurelyseverelygenuinelyseeminglytechnicallythoroughlyimportantlysurprisinglygentlyseparatelypermanentlyhistoricallyfreelynicelyallegedlypresumablypoliticallytemporarilyindependentlytraditionallyfranklycomplyemotionallyanalystreasonablynamelyutterlyaccordinglydeliberatelynotablyformallysecretlyprivatelyspeciallyfirmlykindlyconsiderablyquarterlyaccuratelydesperatelyfinanciallysallybullyingrandomlyfortunatelycontinuouslylightlysociallyexplicitlysupposedlysubstantiallylilydramaticallyinternationallylynchconsequentlycostlyreadilybutterflyluckilybeautifullyterriblycontinuallyanalyzedarguablyinevitablyindividuallysharplysincerelypositivelyhollyyearlycriticallyundoubtedlybullymollyillegallyextensivelylivelytimelysecondlyanalyzeanalystsmonopolypromptlysteadilynationallyimplyoverlywhollyeconomicallybroadlygloballycollectivelyintentionallyrelyingalternativelythankfullysufficientlypredominantlyloudlyanalysesefficientlybodilyjointlyjellysoftlyanalyticsremarkablyfundamentallytightlycatalystheavenlyunusuallyprofessionallyideallyremotelysupplyinginternallyironicallycomfortablyappropriatelyexceptionallyfirstlyrightlyanalyticalpresentlyvoluntarilyhourlywildlyproudlyanalyzingroutinelyapocalypseindirectlypreferablyunexpectedlymanuallyflyerslastlynegativelymutuallysmoothlyvisuallygladlystrangelycommerciallystatisticallymanlycasuallygeneticallyevenlyhugelynarrowlydrasticallyindefinitelypolypolymeramazinglyadequatelyculturallytheoreticallylyricmorallypeacefullyuniversallyaggressivelytallyvastlywiselylooselyviolentlyunanimouslywillyfalselyfreshlycurlyevidentlyscholarlyinterestinglybrutallyinherentlyperiodicallyflyerimplyingsilentlywillinglyconvenientlyjollyimmenselyincorrectlyoddlycalmlyabruptlymoderatelyreplyingwonderfullydollyswiftlyuniquelyradicallyadmittedlyoverwhelminglyconverselydistinctlyfinelyintenselysystematicallymassivelyinfinitelyprofoundlyincidentallyridiculouslycomparativelychillymultiplyknowinglyconsciouslyneatlyeagerlyfamouslyhorriblydearlynightlyanalysedurgentlyexpresslyparalysispatientlyprogressivelyanalyseanomalyvaguelypolitelypainfullydangerouslyrespectfully