Skip to content

Word lists

Words With LY

7,268 words contain the letter pair LY, including only, really, family, actually. Most common first.

Highest scoring

  • quizzically43
  • psychoanalyzing38
  • psychoanalyzed37
  • dizzyingly36
  • psychoanalyzes36
  • coenzymatically36
  • jazzily35
  • psychoanalyze35

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first7,268

Showing the 400 most common of 7,268 words. The length links below give complete lists.

onlyreallyfamilyactuallyearlyprobablyespeciallylikelyfinallyexactlyusuallysimplycurrentlydailyrecentlynearlyquicklycertainlycompletelyabsolutelyimmediatelydefinitelyparticularlygenerallyseriouslyclearlyeasilyanalysisliterallydirectlyfullyhighlyholyeventuallytrulymostlytotallypreviouslyapplysupplyobviouslyapparentlyextremelypossiblyflyslightlylovelyentirelyflyinghonestlysuddenlyoriginallylyingrelativelyspecificallyfriendlyproperlyapproximatelyslowlybasicallytypicallyunfortunatelylargelyassemblyperfectlymainlyweeklynormallypersonallyultimatelyhopefullyfrequentlysurelywidelyheavilysignificantlyhardlycloselyconstantlyofficiallyregularlyautomaticallyreplyfairlymonthlybarelyinitiallyeffectivelynaturallyprimarilynecessarilyshortlystronglycarefullyrespectivelysuccessfullybadlykellydeeplyuglynewlyrarelyessentiallylatelysillyequallypotentiallyoccasionallycommonlyincrediblyincreasinglymerelyroughlylyricsrallyrapidlybillygreatlyunlikelypartlysimilarlyphysicallyrelypubliclyvirtuallylonelyapplyingformerlyexclusivelyconsistentlyactivelyinstantlydifferentlysubsequentlysafelybrieflyaccidentallylegallycorrectlygraduallyrepeatedlysolelymentallypreciselyadditionallypartiallypracticallysadlyunderlyingsimultaneouslydeadlyannuallystrictlyelderlyquietlysexuallyreportedlyopenlyhappilylocallyallybellypoorlypurelyseverelygenuinelyseeminglytechnicallythoroughlyimportantlysurprisinglygentlyseparatelypermanentlyhistoricallyfreelynicelyallegedlypresumablypoliticallytemporarilyindependentlytraditionallyfranklycomplyemotionallyanalystreasonablynamelyutterlyaccordinglydeliberatelynotablyformallysecretlyprivatelyspeciallyfirmlykindlyconsiderablyquarterlyaccuratelydesperatelyfinanciallysallybullyingrandomlyfortunatelycontinuouslylightlysociallyexplicitlysupposedlysubstantiallylilydramaticallyinternationallylynchconsequentlycostlyreadilybutterflyluckilybeautifullyterriblycontinuallyanalyzedarguablyinevitablyindividuallysharplysincerelypositivelyhollyyearlycriticallyundoubtedlybullymollyillegallyextensivelylivelytimelysecondlyanalyzeanalystsmonopolypromptlysteadilynationallyimplyoverlywhollyeconomicallybroadlygloballycollectivelyintentionallyrelyingalternativelythankfullysufficientlypredominantlyloudlyanalysesefficientlybodilyjointlyjellysoftlyanalyticsremarkablyfundamentallytightlycatalystheavenlyunusuallyprofessionallyideallyremotelysupplyinginternallyironicallycomfortablyappropriatelyexceptionallyfirstlyrightlyanalyticalpresentlyvoluntarilyhourlywildlyproudlyanalyzingroutinelyapocalypseindirectlypreferablyunexpectedlymanuallyflyerslastlynegativelymutuallysmoothlyvisuallygladlystrangelycommerciallystatisticallymanlycasuallygeneticallyevenlyhugelynarrowlydrasticallyindefinitelypolypolymeramazinglyadequatelyculturallytheoreticallylyricmorallypeacefullyuniversallyaggressivelytallyvastlywiselylooselyviolentlyunanimouslywillyfalselyfreshlycurlyevidentlyscholarlyinterestinglybrutallyinherentlyperiodicallyflyerimplyingsilentlywillinglyconvenientlyjollyimmenselyincorrectlyoddlycalmlyabruptlymoderatelyreplyingwonderfullydollyswiftlyuniquelyradicallyadmittedlyoverwhelminglyconverselydistinctlyfinelyintenselysystematicallymassivelyinfinitelyprofoundlyincidentallyridiculouslycomparativelychillymultiplyknowinglyconsciouslyneatlyeagerlyfamouslyhorriblydearlynightlyanalysedurgentlyexpresslyparalysispatientlyprogressivelyanalyseanomalyvaguelypolitelypainfullydangerouslyrespectfully