Words With MY
713 words contain the letter pair MY, including my, myself, army, economy. Most common first.
Highest scoring
- hypophysectomy37
- demythologizing35
- demythologized34
- demythologizers34
- remythologizing34
- demythologizer33
- demythologizes33
- remythologized33
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first713
Showing the 400 most common of 713 words. The length links below give complete lists.
mymyselfarmyeconomyenemyacademymysteryjimmymysterioustommymythanatomymommyautonomymythsmysteriesdummymythologyastronomymysticmummymysticalyummymyriadstormymythicaltummycreamygloomytammymyrtleblasphemymysteriouslydreamyalchemysteamydichotomyslimytaxonomypolygamymysticismmythologicalmythicmystiquegummysodomyamyldemyelmyemydfumygamyhomyimmylimymynarimyamylsanomyatomybalmybarmybeamyblimyboomycommydoomydormyemydeemydsfilmyflamyfoamygammygemmygermygrimyhammyjammyjemmykumysloamymalmymammymynahmynasmyoidmyomamyopemyopymyrrhmysidmythypalmypigmyplumypommypygmyrammyroomyrummyseamyspumystimystymyswamythymywormyamylicamylumbigamybloomybosomybroomychammychasmychummyclammycrummydaimyodigamyemydesformylgleamygremmyhaulmyinfamykoumysmyasesmyasismycelemyelinmynahsmyomasmyopesmyopiamyopicmyosesmyosinmyosismyoticmyricamyrrhsmysidsmysostmythoimythosmyxoidmyxomaoogamyostomyplummyqualmyrheumyscummyshammyshimmyslummysmarmystemmyswimmywhammyalchymyamylaseamyleneamyloidamyloseamylumsapogamybenomylbionomychlamyschromyldaimyoseponymyexogamyformylsisogamyisonomykoumysskumysesmyalgiamyalgicmycelesmyceliamycosesmycosismycoticmyelinemyelinsmyeloidmyelomamyiasesmyiasismynheermyologymyomatamyopiasmyopiesmyosinsmyosotemyoticsmyotomemyriadsmyricasmyrrhicmyrtlesmysostsmysticsmystifymythiermyxomaspalmyraphlegmysquirmystreamysyngamythrummytrisomyzootomyaeronomyagronomyallogamyamygdalaamygdaleamygduleamylasesamylenesamylogenamyloidsamylosesantinomyantonymyarmywormautogamyautotomybenomylsblossomycarbamylchromylscinnamylcolotomydidynamydummyingendogamyepimysiaeurythmyfarmyardgorblimyhologamyhomogamyhomonymyjemmyingjimmyingkoumyseslobotomymetonymymisogamymonogamymonosomymummyingmyalgiasmycelialmycelianmyceliummyceloidmycetomamycologymyelinesmyelinicmyelitismyelomasmylonitemynheersmyoblastmyogenicmyographmyologicmyopathymyoscopemyositismyosotesmyosotismyotomesmyotoniamyotonicmyriapodmyriopodmyrmidonmystagogmysticlymythiestmyxedemamyxocytemyxomataneomycinpalmyraspolysemypygmyishpygmyismstimyingstymyingsunbeamysynonymytenotomytheonomytommyrottoponymyvagotomyvasotomyviomycinxenogamyxylotomyamygdalaeamygdalesamygdalinamygdulesamylogensamylopsinamyotoniaanisogamyantimycinarchenemyarmywormscarbamylschammyingchlamydeschlamydiachlamysescinnamylscockamamycolostomydemystifydiathermydichogamyepimysiumeurhythmyfarmyardshypergamykanamycinkaryogamykoumyssesleukotomylithotomylobectomymitomycinmycetomasmycofloramycophagymycophilemycotoxinmydriasesmydriasismydriaticmyelocytemyelomatamylonitesmyoblastsmyocardiamyoclonicmyoclonusmyofibrilmyoglobinmyographsmyologiesmyomatousmyoneuralmyopathicmyoscopesmyotoniasmyriapodsmyriopodsmyrmidonsmyrobalanmystagogsmystagogymystifiedmystifiermystifiesmystiquesmythicizemythmakermyxedemasmyxocytesmyxoviralmyxovirusneomycinsparamylumperimysiapolymyxinpuromycinpygmyismsrhizotomyshammyingshimmyingtaphonomytautonymytaxidermyteleonomythingummy