Words With PS
1,830 words contain the letter pair PS, including groups, perhaps, helps, steps. Most common first.
Highest scoring
- psychoanalyzing38
- psychoanalyzed37
- psychoanalyzes36
- psychobiography36
- psychoanalyze35
- psychologizing35
- psychophysicist35
- psychosexuality35
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first1,830
Showing the 400 most common of 1,830 words. The length links below give complete lists.
groupsperhapshelpsstepsrelationshipskeepstroopsupsettipsshipscopsmapsupsstopslipsshopsdropspsychologycorpspsychologicaltripschipscampscollapsecapscupstopscropsclipschampionshipsupsidepopscollapsedstampsdevelopsworkshopsupstairspsychiatricgapsjumpsstripspumpspartnershipseclipseglimpseopsbishopspsychicpsychologisthipstrapscorpsescholarshipspsychooopslampspropssleepsapocalypsecapsulepsychiatristlipstickfootstepsfriendshipslapssnapsloopsrepsslipspseudobumpschampswrapsautopsyupsettingalpstapspsalmupstreampsychiatrypsychologistsgypsylaptopscorpseslapsestartupspsychgripstrumpsepilepsypsihoopswhoopspsychoticpsychestrapsscrapssnapshotcollapsingchopscreepssynopsiscollapseshopsleapsdumpshipsterpsychologicallysweepsupstatepsychedelictempscapsuleshardshipspupscrampspsalmsupsetsrelapsepsychopathheapsbiopsydipsflopswaspswarshipsflipsupscaleripsrampsfingertipsinternshipspsychiatristsmembershipspsychotherapypsychosistownshipsflapslumpssoapswhipsglimpsesslapsampsskipsswapsswampspickupsfellowshipschapsstumpsbackupscyclopsrapspeepssoupsgypsiespseudonymsnapshotscrispscampsitenapspsychoanalysisbicepsrooftopshiccupssweepstakesclampsjumpsuitdealershipssepsisrhapsodysipsscoopseclipsedlineupshipsterssubgroupselapsedoverlapsbattleshipsapseaspsbapsbopscepsdapsdupsfopsgipsgypshapshypsimpskepskipskopslopsmopsnipspapspepspipspsispsstsapssopssupstupsumpswapswopsyapsyipsyupszapszipsapsesapsisatapsbeepsblipsburpscarpsclapsclopscompscoopscopsecoupscrapscuspsdampsdeepsdipsodorpsdripsfrapsgampsgaspsgawpsgimpsgipsyglopsgoopsgorpsgulpsharpshaspshempshumpsjaupsjeepskelpskempsknapsknopslimpslispsloupsmumpsneapsneepsopsinpalpspimpsplopspompspoopspopsyprepspseudpshawpsoaepsoaipsoaspulpsquipsraspsreapsreppsrompsroupsrumpssalpssampsscopsscupsseepssimpsskepsslopssnipssumpsswopstampstarpstipsytumpsturpstyppsvampsveepswarpsweepswhapswhopswimpswispswoopsyaupsyawpsyelpsabampsbebopsbecapsbleepsblimpsbloopscapsidcheapscheepschimpschirpschompschumpsclaspsclompsclumpscopsescrimpscroupscrumpscutupsdipsasdipsosdroopsdropsyelapseequipsestopsflumpsfrumpsgalopsgenipsgetupsgrampsgraspsgrumpsgypsumjalapsjalopsjulepskelepsknospskreepslapsedlapserlapseslapsuslayupsletupslimpsymixupsnetopsopsinsorlopsoxlipspepsinpinupsplumpspolypspopsieprimpspseudspshawspsocidpsychspsyllapsywarrebopsrecapsredipsremapsripsawsalepsscalpsscampsscarpsscaupsscripssculpssepsessetupssharpsshlepsshnapssirupssitupsskelps