Skip to content

Word lists

Words With PS

1,830 words contain the letter pair PS, including groups, perhaps, helps, steps. Most common first.

Highest scoring

  • psychoanalyzing38
  • psychoanalyzed37
  • psychoanalyzes36
  • psychobiography36
  • psychoanalyze35
  • psychologizing35
  • psychophysicist35
  • psychosexuality35

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first1,830

Showing the 400 most common of 1,830 words. The length links below give complete lists.

groupsperhapshelpsstepsrelationshipskeepstroopsupsettipsshipscopsmapsupsstopslipsshopsdropspsychologycorpspsychologicaltripschipscampscollapsecapscupstopscropsclipschampionshipsupsidepopscollapsedstampsdevelopsworkshopsupstairspsychiatricgapsjumpsstripspumpspartnershipseclipseglimpseopsbishopspsychicpsychologisthipstrapscorpsescholarshipspsychooopslampspropssleepsapocalypsecapsulepsychiatristlipstickfootstepsfriendshipslapssnapsloopsrepsslipspseudobumpschampswrapsautopsyupsettingalpstapspsalmupstreampsychiatrypsychologistsgypsylaptopscorpseslapsestartupspsychgripstrumpsepilepsypsihoopswhoopspsychoticpsychestrapsscrapssnapshotcollapsingchopscreepssynopsiscollapseshopsleapsdumpshipsterpsychologicallysweepsupstatepsychedelictempscapsuleshardshipspupscrampspsalmsupsetsrelapsepsychopathheapsbiopsydipsflopswaspswarshipsflipsupscaleripsrampsfingertipsinternshipspsychiatristsmembershipspsychotherapypsychosistownshipsflapslumpssoapswhipsglimpsesslapsampsskipsswapsswampspickupsfellowshipschapsstumpsbackupscyclopsrapspeepssoupsgypsiespseudonymsnapshotscrispscampsitenapspsychoanalysisbicepsrooftopshiccupssweepstakesclampsjumpsuitdealershipssepsisrhapsodysipsscoopseclipsedlineupshipsterssubgroupselapsedoverlapsbattleshipsapseaspsbapsbopscepsdapsdupsfopsgipsgypshapshypsimpskepskipskopslopsmopsnipspapspepspipspsispsstsapssopssupstupsumpswapswopsyapsyipsyupszapszipsapsesapsisatapsbeepsblipsburpscarpsclapsclopscompscoopscopsecoupscrapscuspsdampsdeepsdipsodorpsdripsfrapsgampsgaspsgawpsgimpsgipsyglopsgoopsgorpsgulpsharpshaspshempshumpsjaupsjeepskelpskempsknapsknopslimpslispsloupsmumpsneapsneepsopsinpalpspimpsplopspompspoopspopsyprepspseudpshawpsoaepsoaipsoaspulpsquipsraspsreapsreppsrompsroupsrumpssalpssampsscopsscupsseepssimpsskepsslopssnipssumpsswopstampstarpstipsytumpsturpstyppsvampsveepswarpsweepswhapswhopswimpswispswoopsyaupsyawpsyelpsabampsbebopsbecapsbleepsblimpsbloopscapsidcheapscheepschimpschirpschompschumpsclaspsclompsclumpscopsescrimpscroupscrumpscutupsdipsasdipsosdroopsdropsyelapseequipsestopsflumpsfrumpsgalopsgenipsgetupsgrampsgraspsgrumpsgypsumjalapsjalopsjulepskelepsknospskreepslapsedlapserlapseslapsuslayupsletupslimpsymixupsnetopsopsinsorlopsoxlipspepsinpinupsplumpspolypspopsieprimpspseudspshawspsocidpsychspsyllapsywarrebopsrecapsredipsremapsripsawsalepsscalpsscampsscarpsscaupsscripssculpssepsessetupssharpsshlepsshnapssirupssitupsskelps