Words With RY
2,356 words contain the letter pair RY, including very, every, everything, try. Most common first.
Highest scoring
- hypopharynxes36
- exoerythrocytic35
- hypopharynx34
- cryptozoology33
- laryngectomized33
- haphazardry32
- phytochemistry32
- archaeopteryxes32
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first2,356
Showing the 400 most common of 2,356 words. The length links below give complete lists.
veryeveryeverythingtrycountrytryingeveryonestoryhistorymilitaryindustrysorrycenturysecretarynecessarycarrytheoryprimarylibraryworryeverybodymemorydryhenryinjuryvictoryharryentryangryeverywheresurgeryministrycarryingterritorycrydeliveryrecoverycategorycryingfactorysecondaryanniversarybatteryjurygallerycontemporarytemporaryeverydayhungrymysterydiscoveryordinarymarrypoetrycrystalscarysummaryglorysalaryextraordinaryluxurychemistryelementaryliterarylaboratorydocumentaryjerryvaryinquiryterrytreasurylegendaryregulatoryperryslaverycommentarycherryadvisoryunnecessaryparliamentarycontraryrevolutionarypreliminaryhurryinventoryboundarymandatoryjewelryworryingmonetarydairydiaryfairygrocerylaundrycemeteryferrymercurymachinerydictionaryvoluntarylotteryberryrobberyvaryingcurryinfantryartillerybinarydirectorysanctuarysubsidiarycountrysidefurytoryfryburymiserynurserygeometryjudiciaryivorykerryarbitrarymerryimagerymissionaryvocabularyevolutionaryrespiratoryhairycavalryrivalryimaginarycrystalsregistrystatutorymarryingveterinarydisciplinarydryingauxiliaryjewellerysolitarystrawberryinflammatoryobservatorydietarypotterycompulsoryforestryscenerysensorybakeryproprietarybreweryhonorarystorytellingarterymonasteryblackberryqueryaccessorystationarywearyrotaryslipperytrajectorycryptoquarrybraverywaryfierymasteryrosemarysatisfactoryfurryculinaryplanetaryencryptionpsychiatrycomplementarycorydryerpoultryseminarypastrytertiarycustomaryryesymmetryintroductoryancestrypulmonaryraspberryrefineryhereditarycontradictorydiscriminatoryparrycanaryburglarypreparatoryrepositoryfryingacrylicbigotryencryptedvisionaryenquiryadulterycoronaryobituarysherrybriberycentenarydentistrypredatoryobligatoryexemplarysanitarybeneficiaryweaponrybiochemistrysupplementaryburyingmasonrycomplimentaryembryoinfirmaryinvoluntaryceleryfoundrysupervisoryperjuryurinaryexplanatoryemerywineryblueberryperipheryconservatoryembryosmockeryadversarystationeryblurryestuarymercenarydiscretionaryarcheryauditorytapestryderogatoryembroiderycrystallinepantrycrypticembryonicitinerarycountrymenarmoryfisherydistilleryreactionarylorryoutcrymigratoryairyparamilitaryderrygentrywateryforgeryglossaryexploratoryintermediarypenitentiarycranberryrudimentaryrosarybudgetarystarrymulberrytributarysorcerysedentarydowrysugarytreacherycookeryhickoryartistrydormitoryflurrynotaryparticipatorydorycryptliveryplenarypurgatorysedimentarydispensaryprydrearysentryaneurysmchivalrymomentarystorytellerallegorycircuitryunitaryancillarycelebratoryfiduciaryincendiaryunsatisfactorymortuaryprioryolfactorycheerycutleryexpirysavorysilverytelemetryfryersultrycalvaryprecautionaryphosphorylationgoryrepertorycarpentryconstabularyflatteryspectrometryconfectionerycollierycautionaryinhibitoryryawryaeryarylawrydryseeryeyrylorymirynaryoryxryasryesrykeryndryotscrysprywiryalaryambryaperyarylsbaryebeeryberylburrycharyclarycowrydearydecrydryaddrylyfaeryfirryglarygurryherryhoarykaurylearyleerylourymoorymurryochryoneryovarypeerypryerredryrefryretryrykedrykes