Skip to content

Word lists

Words With RY

2,356 words contain the letter pair RY, including very, every, everything, try. Most common first.

Highest scoring

  • hypopharynxes36
  • exoerythrocytic35
  • hypopharynx34
  • cryptozoology33
  • laryngectomized33
  • haphazardry32
  • phytochemistry32
  • archaeopteryxes32

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first2,356

Showing the 400 most common of 2,356 words. The length links below give complete lists.

veryeveryeverythingtrycountrytryingeveryonestoryhistorymilitaryindustrysorrycenturysecretarynecessarycarrytheoryprimarylibraryworryeverybodymemorydryhenryinjuryvictoryharryentryangryeverywheresurgeryministrycarryingterritorycrydeliveryrecoverycategorycryingfactorysecondaryanniversarybatteryjurygallerycontemporarytemporaryeverydayhungrymysterydiscoveryordinarymarrypoetrycrystalscarysummaryglorysalaryextraordinaryluxurychemistryelementaryliterarylaboratorydocumentaryjerryvaryinquiryterrytreasurylegendaryregulatoryperryslaverycommentarycherryadvisoryunnecessaryparliamentarycontraryrevolutionarypreliminaryhurryinventoryboundarymandatoryjewelryworryingmonetarydairydiaryfairygrocerylaundrycemeteryferrymercurymachinerydictionaryvoluntarylotteryberryrobberyvaryingcurryinfantryartillerybinarydirectorysanctuarysubsidiarycountrysidefurytoryfryburymiserynurserygeometryjudiciaryivorykerryarbitrarymerryimagerymissionaryvocabularyevolutionaryrespiratoryhairycavalryrivalryimaginarycrystalsregistrystatutorymarryingveterinarydisciplinarydryingauxiliaryjewellerysolitarystrawberryinflammatoryobservatorydietarypotterycompulsoryforestryscenerysensorybakeryproprietarybreweryhonorarystorytellingarterymonasteryblackberryqueryaccessorystationarywearyrotaryslipperytrajectorycryptoquarrybraverywaryfierymasteryrosemarysatisfactoryfurryculinaryplanetaryencryptionpsychiatrycomplementarycorydryerpoultryseminarypastrytertiarycustomaryryesymmetryintroductoryancestrypulmonaryraspberryrefineryhereditarycontradictorydiscriminatoryparrycanaryburglarypreparatoryrepositoryfryingacrylicbigotryencryptedvisionaryenquiryadulterycoronaryobituarysherrybriberycentenarydentistrypredatoryobligatoryexemplarysanitarybeneficiaryweaponrybiochemistrysupplementaryburyingmasonrycomplimentaryembryoinfirmaryinvoluntaryceleryfoundrysupervisoryperjuryurinaryexplanatoryemerywineryblueberryperipheryconservatoryembryosmockeryadversarystationeryblurryestuarymercenarydiscretionaryarcheryauditorytapestryderogatoryembroiderycrystallinepantrycrypticembryonicitinerarycountrymenarmoryfisherydistilleryreactionarylorryoutcrymigratoryairyparamilitaryderrygentrywateryforgeryglossaryexploratoryintermediarypenitentiarycranberryrudimentaryrosarybudgetarystarrymulberrytributarysorcerysedentarydowrysugarytreacherycookeryhickoryartistrydormitoryflurrynotaryparticipatorydorycryptliveryplenarypurgatorysedimentarydispensaryprydrearysentryaneurysmchivalrymomentarystorytellerallegorycircuitryunitaryancillarycelebratoryfiduciaryincendiaryunsatisfactorymortuaryprioryolfactorycheerycutleryexpirysavorysilverytelemetryfryersultrycalvaryprecautionaryphosphorylationgoryrepertorycarpentryconstabularyflatteryspectrometryconfectionerycollierycautionaryinhibitoryryawryaeryarylawrydryseeryeyrylorymirynaryoryxryasryesrykeryndryotscrysprywiryalaryambryaperyarylsbaryebeeryberylburrycharyclarycowrydearydecrydryaddrylyfaeryfirryglarygurryherryhoarykaurylearyleerylourymoorymurryochryoneryovarypeerypryerredryrefryretryrykedrykes