Skip to content

Word lists

Words With SH

5,383 words contain the letter pair SH, including she, should, show, shit. Most common first.

Highest scoring

  • showbizzy38
  • showbizzes36
  • churchmanships31
  • bolshevizing30
  • bushwhacking30
  • churchmanship30
  • disharmonizing30
  • sycophantishly30

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first5,383

Showing the 400 most common of 5,383 words. The length links below give complete lists.

sheshouldshowshitshortshowsshotshareenglishwishrelationshippublishedshallfinishedshipcashfinishfishshownestablishedshopshowingshowedfreshpushfashionshutshootingleadershipshootshapesharedshoppingrelationshipsshoessharingshirtshotssharesshiftcrashshameshipschampionshipshippingshowershoulderbushrushsharppartnershipfishingshortlybullshitmembershipwashshockestablishflashshadowpushingpushedtrashestablishmentsheetownershipshellfriendshipbishopshapedpublishingjoshwishesshopsassholepunishmentshakeshoreshieldfinishingpolishworshipshockedsheltershoemarshallshedbrushshirtsshorterdishfleshdistinguishedsheepshoulderscrushshineashshyshadesheetssheriffsunshinewelshworkshopscholarshipaccomplishedharshdisheswashingpublisherparishselfishestablishingsharkwashedpublishshockingcitizenshipsmashshawshakingshortspublishersshoutashamedshadowsshookshooteraccomplishshittycrashedshallowshanghaicrushedshippedthresholdchampionshipsshelffishersheershiftsdashshadeswishedpunishedshapesrushedshiftedshiningfreshmanshiftingtownshipclashshoutingsharksshootspunishrushingwishingfashionedshareholdersashesshellsshowcasedanishoffshoreshortagegoshshaftshuttlefinishesshepherdfoolishsharplyshowersshinyworkshopsmarshcrashesmarshalrubbishshieldsdistinguishshfellowshipsplashcensorshipsmashedcrashingestablishmentsshavecrushingrefreshingarchbishoppartnershipsbashshahshawnshotgunflushbishopsshrimpshoutedshorespushesshelvespolishedshipmentscholarshipsmeshkashmirflagshipshatteredaccomplishmentsshrineshrinkchildishsherlockshapingvanishedunfinishedsponsorshipshadyassholesshuttingmushroomsstylishshinshalefisheriesshootingsaccomplishmentsushiflashingsheltersrashdiminishedastonishingfriendshipsshoveshavedbacklashshooterssmashingslashshakesrefreshfishermenfurnishedfashionableshitsshipmentsdictatorshiphashsquashmushroomshareholdershavingshutdownabolishedfreshlyinternshippremiershipshakensheikhshinesshesfetishshribushesbrushescushionshampoobrushedcashiershamefulshortestblushsheilaflasheshardshiplushmashambushshopperspublishesstashshoutsshocksclashesflourishwatershedashorecherishdishonestdemolishedfreshwaterushershootoutshovelbrushingpunishingshortagesshortenedshutsgunshotshuffleshowdownfishermanshedsabolishshuttershelteredhushleashshireflashbackunleashedestablishesapprenticeshipshoveddiminishflashlightshamshakybashingshreddedshortcomingslashesshrinkingshacknutshellfisheslavishdealershipunleashcherishedwindshieldunpublishedposhshearsherryflushingsheddingshittingmashedsharifvanishreddishbanishedfreshmensnapshotshamelessrefurbishedlashsheashortentoothbrushdiminishingpunishmentsshrubsanguishshamingflashbackshandshakespaceshipshacatfishflashedshortcutimpoverisheddistinguishingshaltsheenwashershowcasingplushshivashruggeddashboardhardshipsshipbuildingshredperishrelishparishesflourishedfurnishingsrushesshellyshorelineshatteringspreadsheetshrugwashesshadingperishedwarshipspunishable