Words With SH
5,383 words contain the letter pair SH, including she, should, show, shit. Most common first.
Highest scoring
- showbizzy38
- showbizzes36
- churchmanships31
- bolshevizing30
- bushwhacking30
- churchmanship30
- disharmonizing30
- sycophantishly30
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first5,383
Showing the 400 most common of 5,383 words. The length links below give complete lists.
sheshouldshowshitshortshowsshotshareenglishwishrelationshippublishedshallfinishedshipcashfinishfishshownestablishedshopshowingshowedfreshpushfashionshutshootingleadershipshootshapesharedshoppingrelationshipsshoessharingshirtshotssharesshiftcrashshameshipschampionshipshippingshowershoulderbushrushsharppartnershipfishingshortlybullshitmembershipwashshockestablishflashshadowpushingpushedtrashestablishmentsheetownershipshellfriendshipbishopshapedpublishingjoshwishesshopsassholepunishmentshakeshoreshieldfinishingpolishworshipshockedsheltershoemarshallshedbrushshirtsshorterdishfleshdistinguishedsheepshoulderscrushshineashshyshadesheetssheriffsunshinewelshworkshopscholarshipaccomplishedharshdisheswashingpublisherparishselfishestablishingsharkwashedpublishshockingcitizenshipsmashshawshakingshortspublishersshoutashamedshadowsshookshooteraccomplishshittycrashedshallowshanghaicrushedshippedthresholdchampionshipsshelffishersheershiftsdashshadeswishedpunishedshapesrushedshiftedshiningfreshmanshiftingtownshipclashshoutingsharksshootspunishrushingwishingfashionedshareholdersashesshellsshowcasedanishoffshoreshortagegoshshaftshuttlefinishesshepherdfoolishsharplyshowersshinyworkshopsmarshcrashesmarshalrubbishshieldsdistinguishshfellowshipsplashcensorshipsmashedcrashingestablishmentsshavecrushingrefreshingarchbishoppartnershipsbashshahshawnshotgunflushbishopsshrimpshoutedshorespushesshelvespolishedshipmentscholarshipsmeshkashmirflagshipshatteredaccomplishmentsshrineshrinkchildishsherlockshapingvanishedunfinishedsponsorshipshadyassholesshuttingmushroomsstylishshinshalefisheriesshootingsaccomplishmentsushiflashingsheltersrashdiminishedastonishingfriendshipsshoveshavedbacklashshooterssmashingslashshakesrefreshfishermenfurnishedfashionableshitsshipmentsdictatorshiphashsquashmushroomshareholdershavingshutdownabolishedfreshlyinternshippremiershipshakensheikhshinesshesfetishshribushesbrushescushionshampoobrushedcashiershamefulshortestblushsheilaflasheshardshiplushmashambushshopperspublishesstashshoutsshocksclashesflourishwatershedashorecherishdishonestdemolishedfreshwaterushershootoutshovelbrushingpunishingshortagesshortenedshutsgunshotshuffleshowdownfishermanshedsabolishshuttershelteredhushleashshireflashbackunleashedestablishesapprenticeshipshoveddiminishflashlightshamshakybashingshreddedshortcomingslashesshrinkingshacknutshellfisheslavishdealershipunleashcherishedwindshieldunpublishedposhshearsherryflushingsheddingshittingmashedsharifvanishreddishbanishedfreshmensnapshotshamelessrefurbishedlashsheashortentoothbrushdiminishingpunishmentsshrubsanguishshamingflashbackshandshakespaceshipshacatfishflashedshortcutimpoverisheddistinguishingshaltsheenwashershowcasingplushshivashruggeddashboardhardshipsshipbuildingshredperishrelishparishesflourishedfurnishingsrushesshellyshorelineshatteringspreadsheetshrugwashesshadingperishedwarshipspunishable