Skip to content

Word lists

Words With TC

998 words contain the letter pair TC, including watch, match, watching, catch. Most common first.

Highest scoring

  • czarevitches31
  • switchbacking30
  • whatchamacallit30
  • czarevitch29
  • switchbacked29
  • hitchhiking27
  • switchbacks27
  • hotchpotches27

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first998

Showing the 400 most common of 998 words. The length links below give complete lists.

watchmatchwatchingcatchbitchwatchedkitchenswitchmatchespitchdutchoutcomestretchpatchcatchingscratchswitchedwitchbankruptcywatchesmatchingoutcomesswitchingsketchmatchedcatchesbatchditchclutchstretchedpatchesstretchingbitchespitchedswitcheshatchfletcherpitchernotchtwitchdispatchbutcherpitchingsketchesstretchesscotchfetchnightclubstitchpitcheswitchesdispatchedstitchesscratchingsitcomsuitcasecatchersnatchcatchyscratchedsnatchedthatcherketchupglitchscratchesshortcomingsrematchpitcherspostcardhitchwitchcraftmatchupkitchensbutchitchingwretcheditchfetchedshortcutitchylatchmatchmakingwatcherspostcardscrotchditchedfitchetchedhatchedbatchesstretchersketchystitchedoutcrybotchedpatchedbitchingwatchdogclutchingclutchesshortcutsratchetglitchesetchingunmatchedcrutchesstitchingnightclubssnitchditchesmismatchpatchworkoutcastwatchfulbitchyhatchetdispatcherdispatchesbutchersditchingdutchmanhatchinghutchnotchedstreetcarwatchersuitcaseshatchescatchmentwatchmanbutcheredpitchforksketchingpostcodetwitchinghatchbacksnatchingfetchingsketchedetchaitchbotchcutchhotchketchletchmutchnatchratchretchrotchvetchblotchbotchycratchcrutchcultchdatchaetcheretchesfitchyfletchflitchgrutchhootchitcheditchesklatchkvetchlitchinautchpatchypitchyquitchrotchescutchslatchsmutchswatchtetchythatchwitchywretchabbotcyaitchesbatchedbatcherbewitchbitchedblotchybotcherbotchesbutchescatcallcatchupcatclawclutchycutchesdatchasditcheretchantetchersfetcherfetchesfitcheefitchesfitchetfitchewflatcapflatcarglitchyhatchelhatcherhitchedhitcherhitcheshotcakehotchedhotcheshutchedhutchesitchieritchilykatcinaketcheskvetchylatchedlatcheslatchetletchedletcheslitchismatchermutchesnitchienotchernotchesnutcaseoatcakeoutchidoutcookoutcropoutcrowpatcherpetcockratchesrepatchretchedretchesrotchessatchelsitcomssmutchysnatchysplotchtetchedthatchytwitchyunhitchunlatchvetcheswitchedbatchersbatchingbirrotchbitcherybitchierbitchilyblotchedblotchesbotchersbotcherybotchierbotchilybotchingbrevetcybritchesbutcherycarritchcatcallscatchallcatcherscatchflycatchiercatchupscatclawschatchkachatchkechitchatclutchedcornetcycratchescrotchedcrotchescrotchetcrutchedcultchescutcherydespatchditchersdogwatchdutchmeneldritchetceteraetchantsetchingsfetchersfitchetsfitchewsflatcapsflatcarsfletchedfletchesflitchedflitchesgrutchedgrutcheshatcheckhatchelshatchershatcheryhatchetshatchwayhitchershitchinghootcheshotcakeshotchinghotchpothutchingitchiestitchingskatchinakatcinasketchupsklatcheskvetchedkvetcheslatchetslatchinglatchkeyletchingmatchboxmatchersmatchupsmidwatchmispatchmutchkinnautchesnightcapnitchiesnotchersnotchingnutcasesnuthatchoatcakesoutbitchoutcaperoutcasteoutcastsoutcatchoutcaviloutcharmoutcheatoutchideoutclassoutclimboutclomboutcoachoutcooksoutcountoutcrawloutcriedoutcriesoutcropsoutcrossoutcrowsoutcurseoutcurveoutmatchoutpitchoutwatchparritchpatcherspatchierpatchilypatchingpetcockspitchierpitchilypitchmanpitchmenpitchoutpostcavapostcouppotlatchquitchesratchetsresketchrestitch