Skip to content

Word lists

Words With TH

5,641 words contain the letter pair TH, including the, that, with, this. Most common first.

Highest scoring

  • thymectomizing36
  • thymectomized35
  • demythologizing35
  • exoerythrocytic35
  • microearthquake35
  • photosynthesize35
  • hypothesizing34
  • thymectomizes34

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first5,641

Showing the 400 most common of 5,641 words. The length links below give complete lists.

thethatwiththistheytheirtherethemotherthanthinkthenthesethosethroughsomethingboththreethingsanotherthingwithoutthoughtnothinganythingeverythingthoughthanktogetherhealthwithinthanksothersdeathsouthmonthsnortheitherthirdratherwhetherfurtheralthoughfathermonthmotherthinkingworththemselvesbrotherearthtruthgrowththroughoutauthorthussmiththeoryotherwiseweatherthereforenorthernsouthernmouththrowfourthfaithauthoritymethodhealthystrengthfifththinksbirthlengthneitherthousandsbirthdayyouththoughtsclothespathbrothersmethodsthousandauthoritiesthemethreatteethdepthcatholicbathroomdeathsbreaththeatretherapywealthmonthlyauthorsthinclothingthickthrewmathbaththreadthoforthsmooththrownthrowingbothersixththirtythreatenedleathertheaterathletescommonwealthethnicmothersthroatworthythreatsbreathinggatheredbreatheseventhgatheringneverthelessgatherbeneathgrandfatherfurthermoretheorieswealthyeighthethicsthemesthreateningthoumarathonsoutheastearthquakemathematicsthundernorthwestgrandmothertheftathleticauthorizedthythroneathletepatheticboothfaithfulsouthwestthoroughlymythtooththrowsfathersunderneathninthethicalaltogethernortheastruthrhythmthesiswithdrawwithdrawaltheethermalauthenticstrengthennonethelessmathematicalthanksgivingcloththerebythresholdpathswidthaestheticalgorithmenthusiasmthumbsympathytheoreticalcathedralthoroughtherapistthereafteroaththeirsbotheredsyntheticthemedthreatenthrilledorthodoxthankfultenthlengthstheologyanthemthirdsthrillertheresaftermathwithdrawnthirteenthiefbethheathertheatershypothesislethalthrustfartherlengthythreadsbrotherhoodtherapeuticcatholicssynthesisenthusiasticthruthievespanthersstrengthsthoughtfulbreakthroughtimothyathleticsworthlessmethodologystrengtheninghealthieralgorithmssympatheticfilthywarmththronestwentieththankfullyfeathersnorthwesterndepthspythonpathwaytheologicalheathnineteenthmathsmythsthicknessthreatensforthcomingthereofthirstysweetheartworthwhileauthorizationthighasthmathriveethnicitymouthsthrillempathywithdrewunhealthytheoremwraththumbstruthsfeatherstrengthenedbathingsmoothlytheatricalbathsthighsbathroomssoutheasterngothicpantherruthlessmethodistwithstandanthropologybirthsthirstthankedpathwaysmythologynortheasternsouthwesterntheoreticallybotheringhathmethatheistthrivingbandwidthearthquakesyouthsapartheidarthritisoverthrowthrillingauthorisedcourthousehypotheticalmotherfuckerthickeradulthoodauthenticitybreathtakingaestheticsauthoritarianyouthfulpathologyunauthorizedthugslithiumthinnerenthusiastschemotherapybotherslighthouseethicmethanetheatresstealththyroidthankingtwelfthbrethrengatheringsparenthoodtrustworthymothsabbathauthoredtherapiesnoteworthythugthornelevenththinkersanthologybirthdayseighteenthnotwithstandingbreadthrethinkthatcherthrottleethanolenthusiastatheismbathtubsoothingwavelengthberthrhythmsmythicalgodfathertherapiststhereintruthfultheoristschildbirthwithdrawalswithdrawingfilthetherthriftmammothrebirtharithmeticauthoritativebroththinkerbethesdarhythmicanesthesiaauthorizesixteenthtoothbrushthroatsbirthplacemotherhoodtoothpastewreathwithheld