Words With TH
5,641 words contain the letter pair TH, including the, that, with, this. Most common first.
Highest scoring
- thymectomizing36
- thymectomized35
- demythologizing35
- exoerythrocytic35
- microearthquake35
- photosynthesize35
- hypothesizing34
- thymectomizes34
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first5,641
Showing the 400 most common of 5,641 words. The length links below give complete lists.
thethatwiththistheytheirtherethemotherthanthinkthenthesethosethroughsomethingboththreethingsanotherthingwithoutthoughtnothinganythingeverythingthoughthanktogetherhealthwithinthanksothersdeathsouthmonthsnortheitherthirdratherwhetherfurtheralthoughfathermonthmotherthinkingworththemselvesbrotherearthtruthgrowththroughoutauthorthussmiththeoryotherwiseweatherthereforenorthernsouthernmouththrowfourthfaithauthoritymethodhealthystrengthfifththinksbirthlengthneitherthousandsbirthdayyouththoughtsclothespathbrothersmethodsthousandauthoritiesthemethreatteethdepthcatholicbathroomdeathsbreaththeatretherapywealthmonthlyauthorsthinclothingthickthrewmathbaththreadthoforthsmooththrownthrowingbothersixththirtythreatenedleathertheaterathletescommonwealthethnicmothersthroatworthythreatsbreathinggatheredbreatheseventhgatheringneverthelessgatherbeneathgrandfatherfurthermoretheorieswealthyeighthethicsthemesthreateningthoumarathonsoutheastearthquakemathematicsthundernorthwestgrandmothertheftathleticauthorizedthythroneathletepatheticboothfaithfulsouthwestthoroughlymythtooththrowsfathersunderneathninthethicalaltogethernortheastruthrhythmthesiswithdrawwithdrawaltheethermalauthenticstrengthennonethelessmathematicalthanksgivingcloththerebythresholdpathswidthaestheticalgorithmenthusiasmthumbsympathytheoreticalcathedralthoroughtherapistthereafteroaththeirsbotheredsyntheticthemedthreatenthrilledorthodoxthankfultenthlengthstheologyanthemthirdsthrillertheresaftermathwithdrawnthirteenthiefbethheathertheatershypothesislethalthrustfartherlengthythreadsbrotherhoodtherapeuticcatholicssynthesisenthusiasticthruthievespanthersstrengthsthoughtfulbreakthroughtimothyathleticsworthlessmethodologystrengtheninghealthieralgorithmssympatheticfilthywarmththronestwentieththankfullyfeathersnorthwesterndepthspythonpathwaytheologicalheathnineteenthmathsmythsthicknessthreatensforthcomingthereofthirstysweetheartworthwhileauthorizationthighasthmathriveethnicitymouthsthrillempathywithdrewunhealthytheoremwraththumbstruthsfeatherstrengthenedbathingsmoothlytheatricalbathsthighsbathroomssoutheasterngothicpantherruthlessmethodistwithstandanthropologybirthsthirstthankedpathwaysmythologynortheasternsouthwesterntheoreticallybotheringhathmethatheistthrivingbandwidthearthquakesyouthsapartheidarthritisoverthrowthrillingauthorisedcourthousehypotheticalmotherfuckerthickeradulthoodauthenticitybreathtakingaestheticsauthoritarianyouthfulpathologyunauthorizedthugslithiumthinnerenthusiastschemotherapybotherslighthouseethicmethanetheatresstealththyroidthankingtwelfthbrethrengatheringsparenthoodtrustworthymothsabbathauthoredtherapiesnoteworthythugthornelevenththinkersanthologybirthdayseighteenthnotwithstandingbreadthrethinkthatcherthrottleethanolenthusiastatheismbathtubsoothingwavelengthberthrhythmsmythicalgodfathertherapiststhereintruthfultheoristschildbirthwithdrawalswithdrawingfilthetherthriftmammothrebirtharithmeticauthoritativebroththinkerbethesdarhythmicanesthesiaauthorizesixteenthtoothbrushthroatsbirthplacemotherhoodtoothpastewreathwithheld