Words With YR
598 words contain the letter pair YR, including lyrics, copyright, syrup, payroll. Most common first.
Highest scoring
- gyrofrequency34
- hyperpyrexias33
- gyrofrequencies33
- hyperpyrexia32
- hyperthyroidism32
- hypothyroidisms32
- sulfinpyrazones32
- hypothyroidism31
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first598
Showing the 400 most common of 598 words. The length links below give complete lists.
lyricscopyrightsyruppayrollpyramidlyricthyroidtyrestyrannytyremyriadmartyrlyricalmartyrstyrantmyrtlepyramidskyrielabyrinthsyringecopyrightedmartyrdomeyrevalkyrietyrantscopyrightstyrannicalbyrebyrleyraeyrygyregyrigyrolyrepyretyrobyresbyrlseyraseyreseyrieeyrirgyralgyredgyresgyrongyrosgyrushyraxlyresmyrrhpyranpyrespyricsatyrsyrentyredtyrosbyrledbyrniebyroadeyriesgyrasegyrategyrenegyringgyronsgyrosekyrieslyratelyrismlyristmyricamyrrhspapyripyranspyrenepyritepyrolapyronepyropepyrrolsatyrsstyraxsyrenssyrinxsyrupssyrupythyrsethyrsityringvalkyrzephyrapyrasebutyralbutyricbutyrinbutyrylbyrlingbyrniesbyroadsdayroomgyrallygyrasesgyratedgyratesgyratorgyreneshayrackhayrickhayridehyraceshyraxesjoyridejoyrodelyratedlyrismslyristsmartyrymyriadsmyricasmyrrhicmyrtlespalmyrapapyralpapyruspyralidpyrenespyreticpyrexiapyrexicpyridicpyritespyriticpyrogenpyrolaspyronespyropespyrosispyrrhicpyrrolepyrrolssatyricsatyridstyrenesyringasyrphidthyrsesthyrsustyronicvalkyrszephyrsapyrasesapyreticautogyroballyragbuckayrobullyragbutyralsbutyratebutyrinsbutyrousbutyrylscollyriacopyreaddayroomsempyrealempyreangyratinggyrationgyratorsgyratorygyroidalgyrostathayrackshayrickshayrideshyracoidjoyriderjoyrideslampyridlevogyrelyratelylyrebirdlyriciselyricismlyricistlyricizelyriformmartyredmartyrlymyriapodmyriopodmyrmidonpalmyraspapyrianpapyrinepayrollsplayroomporphyrypyralidspyranoidpyranosepyrenoidpyrexialpyrexiaspyridinepyriformpyritouspyrogenspyrolizepyrologypyrolyzepyroninepyrostatpyroxenepyrrhicspyrrolespyrrolicpyruvatesatyridsspagyricstyraxesstyrenessyringassyringedsyringessyrinxessyrphiansyrphidsthyreoidthyroidsthyroxinthyrsoidtommyrottyraminetyrannictyrosinewalkyrieautogyrosballyragsbipyramidbuckayrosbullyragsbutyratescollyriumcopyreadsdithyrambempyreanseuthyroidgyrationsgyrfalcongyroplanegyroscopegyrostatshyracoidsjoyriddenjoyridersjoyridinglampyridslathyrismlyrebirdslyricallylyricisedlyriciseslyricismslyricistslyricizedlyricizesmartyriesmartyringmartyrizemyriapodsmyriopodsmyrmidonsmyrobalanpanegyricpapyrusesplayroomsporphyriaporphyrinputtyrootpyramidalpyramidedpyranosespyrenoidspyrethrinpyrethrumpyridinespyridoxalpyrogenicpyrolizedpyrolizespyrolysespyrolysispyrolyticpyrolyzedpyrolyzerpyrolyzespyromancypyromaniapyrometerpyrometrypyroninespyrosisespyrostatspyroxenespyroxenicpyroxylinpyruvatesskyrocketspagyricsspirogyrasyringingsyrphiansthyratronthyristorthyroidalthyroxinethyroxinstommyrotstyraminestyranniestyrannisetyrannizetyrannoustyrocidintyrosinesunlyricalvalkyrieswalkyriesantipyrinebipyramidscollyriumscopyreaderdithyrambsgranophyregyrationalgyrfalconsgyroplanesgyroscopesgyroscopicjoyridingslabyrinthslathyrismslathyriticlyricisinglyricizingmartyrdomsmartyrizedmartyrizesmyrobalanspanegyricspanegyristpapyrologypennyroyalpityriasespityriasispolyrhythmporphyriasporphyriesporphyrinsputtyrootspyracanthapyramidingpyranosidepyrethrinspyrethroidpyrethrumspyridoxalspyridoxinepyrimidinepyrogallolpyrolizingpyrologiespyrolusitepyrolysatepyrolyzatepyrolyzerspyrolyzingpyromaniacpyromaniaspyrometerspyrometricpyrophoricpyroxenitepyroxenoidpyroxylinspyrrhotitesatyriasessatyriasisskyrocketsspirogyrasthyratronsthyristorsthyroxinestyrannisedtyrannisestyrannized