Skip to content

Word lists

Words With YR

598 words contain the letter pair YR, including lyrics, copyright, syrup, payroll. Most common first.

Highest scoring

  • gyrofrequency34
  • hyperpyrexias33
  • gyrofrequencies33
  • hyperpyrexia32
  • hyperthyroidism32
  • hypothyroidisms32
  • sulfinpyrazones32
  • hypothyroidism31

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first598

Showing the 400 most common of 598 words. The length links below give complete lists.

lyricscopyrightsyruppayrollpyramidlyricthyroidtyrestyrannytyremyriadmartyrlyricalmartyrstyrantmyrtlepyramidskyrielabyrinthsyringecopyrightedmartyrdomeyrevalkyrietyrantscopyrightstyrannicalbyrebyrleyraeyrygyregyrigyrolyrepyretyrobyresbyrlseyraseyreseyrieeyrirgyralgyredgyresgyrongyrosgyrushyraxlyresmyrrhpyranpyrespyricsatyrsyrentyredtyrosbyrledbyrniebyroadeyriesgyrasegyrategyrenegyringgyronsgyrosekyrieslyratelyrismlyristmyricamyrrhspapyripyranspyrenepyritepyrolapyronepyropepyrrolsatyrsstyraxsyrenssyrinxsyrupssyrupythyrsethyrsityringvalkyrzephyrapyrasebutyralbutyricbutyrinbutyrylbyrlingbyrniesbyroadsdayroomgyrallygyrasesgyratedgyratesgyratorgyreneshayrackhayrickhayridehyraceshyraxesjoyridejoyrodelyratedlyrismslyristsmartyrymyriadsmyricasmyrrhicmyrtlespalmyrapapyralpapyruspyralidpyrenespyreticpyrexiapyrexicpyridicpyritespyriticpyrogenpyrolaspyronespyropespyrosispyrrhicpyrrolepyrrolssatyricsatyridstyrenesyringasyrphidthyrsesthyrsustyronicvalkyrszephyrsapyrasesapyreticautogyroballyragbuckayrobullyragbutyralsbutyratebutyrinsbutyrousbutyrylscollyriacopyreaddayroomsempyrealempyreangyratinggyrationgyratorsgyratorygyroidalgyrostathayrackshayrickshayrideshyracoidjoyriderjoyrideslampyridlevogyrelyratelylyrebirdlyriciselyricismlyricistlyricizelyriformmartyredmartyrlymyriapodmyriopodmyrmidonpalmyraspapyrianpapyrinepayrollsplayroomporphyrypyralidspyranoidpyranosepyrenoidpyrexialpyrexiaspyridinepyriformpyritouspyrogenspyrolizepyrologypyrolyzepyroninepyrostatpyroxenepyrrhicspyrrolespyrrolicpyruvatesatyridsspagyricstyraxesstyrenessyringassyringedsyringessyrinxessyrphiansyrphidsthyreoidthyroidsthyroxinthyrsoidtommyrottyraminetyrannictyrosinewalkyrieautogyrosballyragsbipyramidbuckayrosbullyragsbutyratescollyriumcopyreadsdithyrambempyreanseuthyroidgyrationsgyrfalcongyroplanegyroscopegyrostatshyracoidsjoyriddenjoyridersjoyridinglampyridslathyrismlyrebirdslyricallylyricisedlyriciseslyricismslyricistslyricizedlyricizesmartyriesmartyringmartyrizemyriapodsmyriopodsmyrmidonsmyrobalanpanegyricpapyrusesplayroomsporphyriaporphyrinputtyrootpyramidalpyramidedpyranosespyrenoidspyrethrinpyrethrumpyridinespyridoxalpyrogenicpyrolizedpyrolizespyrolysespyrolysispyrolyticpyrolyzedpyrolyzerpyrolyzespyromancypyromaniapyrometerpyrometrypyroninespyrosisespyrostatspyroxenespyroxenicpyroxylinpyruvatesskyrocketspagyricsspirogyrasyringingsyrphiansthyratronthyristorthyroidalthyroxinethyroxinstommyrotstyraminestyranniestyrannisetyrannizetyrannoustyrocidintyrosinesunlyricalvalkyrieswalkyriesantipyrinebipyramidscollyriumscopyreaderdithyrambsgranophyregyrationalgyrfalconsgyroplanesgyroscopesgyroscopicjoyridingslabyrinthslathyrismslathyriticlyricisinglyricizingmartyrdomsmartyrizedmartyrizesmyrobalanspanegyricspanegyristpapyrologypennyroyalpityriasespityriasispolyrhythmporphyriasporphyriesporphyrinsputtyrootspyracanthapyramidingpyranosidepyrethrinspyrethroidpyrethrumspyridoxalspyridoxinepyrimidinepyrogallolpyrolizingpyrologiespyrolusitepyrolysatepyrolyzatepyrolyzerspyrolyzingpyromaniacpyromaniaspyrometerspyrometricpyrophoricpyroxenitepyroxenoidpyroxylinspyrrhotitesatyriasessatyriasisskyrocketsspirogyrasthyratronsthyristorsthyroxinestyrannisedtyrannisestyrannized