Words With YT
745 words contain the letter pair YT, including anything, everything, anytime, myth. Most common first.
Highest scoring
- demythologizing35
- exoerythrocytic35
- phytochemically35
- phagocytizing34
- demythologized34
- rhythmizations34
- demythologizers34
- remythologizing34
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first745
Showing the 400 most common of 745 words. The length links below give complete lists.
anythingeverythinganytimemythrhythmpythonanalyticsmythsanalyticaldaytimestorytellingmythologypresbyterianrhythmsmythicalrhythmicanalyticbytescatalyticpolytechnicbytestorytellerponytailelectrolytemythologicalmythicplaytimeelectrolyteshytekytewyteadytacytonfluytflytefyttekyteskythelyticlyttamythyrhytatythewytedwytesadytumbarytabarytebytalkcytonselytrafluytsflytedflytesfytteskythedkytheslyttaelyttasmythoimythosoocytephytolphytonrhytonscythetythedtytheswytingyttriayttricacolyteanolytebarytasbarytesbaryticbytalkscytosolelytronelytrumflytierflytingflytrapkythinglecythilekythimythieroocytesoophyteoxytonepeytralpeytrelphytanephytoidphytolsphytonsprytheepythonsrhytonsscythedscythestythingyttriasyttriumacolytesandesyteanolytesarythmiaarythmicbarytonebiolyticbotrytiscytastercytidinecytogenycytokinecytologycytosinecytosolsdaytimesdialyticelytroidelytrousepiphyteerythemaerythroneurythmyflytiersflytingsflytrapsgeophytegigabytegonocytehemocyteholytidekilobytelecythislecythuslekythoilekythoslekythuslipocytemegabytemonocytemythiestmyxocyteneophyteoophytesoophyticoxytocicoxytocinoxytonespeytralspeytrelsphytanesphytonicpolytenepolytenypolytypepythonicscythingsyncytiatidytipstippytoetrachyteytterbiaytterbicyttriumszoophyteadipocyteamebocyteandesytesanythingsarytenoidarythmiasastrocyteathrocyteautolyticbarytonesbiorhythmbryophytecandytuftcoenocytecytasterscytidinescytokinescytokinincytologiccytolysescytolysincytolysiscytolyticcytoplasmcytosinescytosoliccytotoxiccytotoxinendophyteepiphytesepiphyticerythemaserythrismerythriteerythroiderythronseurhythmyeurythmiceurytopicforsythiageophytesgigabytesgonocyteshalophytehemelytrahemocyteshemolyticholytideshomolytickilobytesleukocytelipocyteslipolyticlyticallymacrocytemegabytesmesophytemicrocytemonocytesmonocyticmucolyticmyelocytemythicizemythmakermyxocytesneophytesosteocyteoxytocicsoxytocinspachyteneparalyticphagocytephenytoinpinocyticplaythingplaytimespolythenepolytonalpolytypespolytypicponytailspresbyterproselytepussytoespyrolyticpythonessrhythmicsrhythmistrhythmizerhytidomesyncytialsyncytiumthymocytetippytoedtippytoestrachytestrachyticxerophyteytterbiasytterbiumzoophytesadipocytesamebocytesamoebocyteamylolyticanxiolyticarrhythmiaarrhythmicarytenoidsastrocytesastrocyticathrocytesbiorhythmsbotrytisesbryophytesbryophyticcandytuftschoanocytecoenocytescoenocyticcytochromecytogeniescytokininscytologiescytologistcytolysinscytopathiccytophiliccytoplasmscytostaticcytotoxinsendophytesendophyticepiphytismerythremiaerythrismserythriteserythrosineurhythmiceurythmicseurythmiesexocytosesexocytosisexocytoticforsythiasgametocyteglycolytichalophyteshalophytichemelytronhepatocytehistiocyteholophytichydrolytichydrophytehygrophyteleukocytesleukocyticlithophytelymphocytemacrocytesmacrocyticmacrophytemelanocytemesophytesmesophyticmicrocytesmicrocyticmyelocytesmyelocyticmythicallymythicizedmythicizermythicizesmythmakersmythmakingmythologermythologicmythomaniamythopoeiamythopoeicosteocytespachytenesparalyticsperiphyticperiphytonphagocytesphagocyticphenytoinsphotolyticphytotoxicplaythingspolyrhythmpolyteniespolytheismpolytheistpolythenesponytailedpresbyterspresbyteryproselytedproselytespsilophyteradiolyticrhythmicalrhythmistsrhythmizedrhythmizesrhytidomesrubythroatsaprophyteshantytownsolvolyticsporophytethymocytestroglodyteunrhythmicxerophytesxerophyticytterbiumsamoebocytesanalyticityanxiolyticsarrhythmiasastrocytomabiorhythmicchamaephytechoanocyteschrysophytecountermythcycadophyte