Skip to content

Word lists

Words With YT

745 words contain the letter pair YT, including anything, everything, anytime, myth. Most common first.

Highest scoring

  • demythologizing35
  • exoerythrocytic35
  • phytochemically35
  • phagocytizing34
  • demythologized34
  • rhythmizations34
  • demythologizers34
  • remythologizing34

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first745

Showing the 400 most common of 745 words. The length links below give complete lists.

anythingeverythinganytimemythrhythmpythonanalyticsmythsanalyticaldaytimestorytellingmythologypresbyterianrhythmsmythicalrhythmicanalyticbytescatalyticpolytechnicbytestorytellerponytailelectrolytemythologicalmythicplaytimeelectrolyteshytekytewyteadytacytonfluytflytefyttekyteskythelyticlyttamythyrhytatythewytedwytesadytumbarytabarytebytalkcytonselytrafluytsflytedflytesfytteskythedkytheslyttaelyttasmythoimythosoocytephytolphytonrhytonscythetythedtytheswytingyttriayttricacolyteanolytebarytasbarytesbaryticbytalkscytosolelytronelytrumflytierflytingflytrapkythinglecythilekythimythieroocytesoophyteoxytonepeytralpeytrelphytanephytoidphytolsphytonsprytheepythonsrhytonsscythedscythestythingyttriasyttriumacolytesandesyteanolytesarythmiaarythmicbarytonebiolyticbotrytiscytastercytidinecytogenycytokinecytologycytosinecytosolsdaytimesdialyticelytroidelytrousepiphyteerythemaerythroneurythmyflytiersflytingsflytrapsgeophytegigabytegonocytehemocyteholytidekilobytelecythislecythuslekythoilekythoslekythuslipocytemegabytemonocytemythiestmyxocyteneophyteoophytesoophyticoxytocicoxytocinoxytonespeytralspeytrelsphytanesphytonicpolytenepolytenypolytypepythonicscythingsyncytiatidytipstippytoetrachyteytterbiaytterbicyttriumszoophyteadipocyteamebocyteandesytesanythingsarytenoidarythmiasastrocyteathrocyteautolyticbarytonesbiorhythmbryophytecandytuftcoenocytecytasterscytidinescytokinescytokinincytologiccytolysescytolysincytolysiscytolyticcytoplasmcytosinescytosoliccytotoxiccytotoxinendophyteepiphytesepiphyticerythemaserythrismerythriteerythroiderythronseurhythmyeurythmiceurytopicforsythiageophytesgigabytesgonocyteshalophytehemelytrahemocyteshemolyticholytideshomolytickilobytesleukocytelipocyteslipolyticlyticallymacrocytemegabytesmesophytemicrocytemonocytesmonocyticmucolyticmyelocytemythicizemythmakermyxocytesneophytesosteocyteoxytocicsoxytocinspachyteneparalyticphagocytephenytoinpinocyticplaythingplaytimespolythenepolytonalpolytypespolytypicponytailspresbyterproselytepussytoespyrolyticpythonessrhythmicsrhythmistrhythmizerhytidomesyncytialsyncytiumthymocytetippytoedtippytoestrachytestrachyticxerophyteytterbiasytterbiumzoophytesadipocytesamebocytesamoebocyteamylolyticanxiolyticarrhythmiaarrhythmicarytenoidsastrocytesastrocyticathrocytesbiorhythmsbotrytisesbryophytesbryophyticcandytuftschoanocytecoenocytescoenocyticcytochromecytogeniescytokininscytologiescytologistcytolysinscytopathiccytophiliccytoplasmscytostaticcytotoxinsendophytesendophyticepiphytismerythremiaerythrismserythriteserythrosineurhythmiceurythmicseurythmiesexocytosesexocytosisexocytoticforsythiasgametocyteglycolytichalophyteshalophytichemelytronhepatocytehistiocyteholophytichydrolytichydrophytehygrophyteleukocytesleukocyticlithophytelymphocytemacrocytesmacrocyticmacrophytemelanocytemesophytesmesophyticmicrocytesmicrocyticmyelocytesmyelocyticmythicallymythicizedmythicizermythicizesmythmakersmythmakingmythologermythologicmythomaniamythopoeiamythopoeicosteocytespachytenesparalyticsperiphyticperiphytonphagocytesphagocyticphenytoinsphotolyticphytotoxicplaythingspolyrhythmpolyteniespolytheismpolytheistpolythenesponytailedpresbyterspresbyteryproselytedproselytespsilophyteradiolyticrhythmicalrhythmistsrhythmizedrhythmizesrhytidomesrubythroatsaprophyteshantytownsolvolyticsporophytethymocytestroglodyteunrhythmicxerophytesxerophyticytterbiumsamoebocytesanalyticityanxiolyticsarrhythmiasastrocytomabiorhythmicchamaephytechoanocyteschrysophytecountermythcycadophyte