4-Letter Words Starting With F
191 4-letter words start with the letter F, including from, find, feel, free. Every word below is valid in Scrabble-style word games.
Highest scoring
- fizz25
- fuzz25
- fozy19
- foxy17
- faze16
- friz16
- futz16
- fuze16
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list191
facefactfadefadofadsfagsfailfainfairfakefallfalxfamefanefangfanofansfardfarefarlfarmfarofartfashfastfatefatsfaunfauxfavafavefawnfaysfazefealfearfeatfeckfedsfeedfeelfeesfeetfehsfellfeltfemefemsfendfensfeodferefernfessfetafetefetsfeudfeusfiarfiatfibsficeficofidofidsfieffifefigsfilafilefillfilmfilofilsfindfinefinkfinofinsfirefirmfirnfirsfiscfishfistfitsfivefixtfizzflabflagflakflamflanflapflatflawflaxflayfleafledfleeflewflexfleyflicflipflitflocfloeflogflopflowflubflueflusfluxfoalfoamfobsfocifoesfogsfogyfohnfoilfoinfoldfolkfondfonsfontfoodfoolfootfopsforaforbfordforeforkformfortfossfoulfourfowlfoxyfoysfozyfraefragfrapfratfrayfreefretfrigfritfrizfroefrogfromfrowfrugfubsfucifuckfudsfuelfugsfugufujifullfumefumyfundfunkfunsfurlfursfuryfusefussfutzfuzefuzzfycefyke