Skip to content

Word lists

4-Letter Words Starting With W

166 4-letter words start with the letter W, including with, will, what, when. Every word below is valid in Scrabble-style word games.

Highest scoring

  • whiz19
  • waxy17
  • wych15
  • wack13
  • waff13
  • wavy13
  • whew13
  • whey13

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list166

wabswackwadewadiwadswadywaeswaffwaftwagewagswaifwailwainwairwaitwakewalewalkwallwalywamewandwanewanswantwanywapswardwarewarkwarmwarnwarpwarswartwarywashwaspwastwatswattwaukwaulwaurwavewavywawlwawswaxywaysweakwealweanwearwebswedsweedweekweelweenweepweerweesweetweftweirwekaweldwellweltwendwenswentweptwerewertwestwetswhamwhapwhatwheewhenwhetwhewwheywhidwhigwhimwhinwhipwhirwhitwhizwhoawhomwhopwhyswichwickwidewifewigswildwilewillwiltwilywimpwindwinewingwinkwinowinswinywipewirewirywisewishwispwisswistwitewithwitswivewoadwoeswogswokewokswoldwolfwombwonkwonswontwoodwoofwoolwooswopswordworeworkwormwornwortwostwotswovewowswrapwrenwritwusswychwyeswylewyndwynnwynswyte