4-Letter Words Starting With W
166 4-letter words start with the letter W, including with, will, what, when. Every word below is valid in Scrabble-style word games.
Highest scoring
- whiz19
- waxy17
- wych15
- wack13
- waff13
- wavy13
- whew13
- whey13
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list166
wabswackwadewadiwadswadywaeswaffwaftwagewagswaifwailwainwairwaitwakewalewalkwallwalywamewandwanewanswantwanywapswardwarewarkwarmwarnwarpwarswartwarywashwaspwastwatswattwaukwaulwaurwavewavywawlwawswaxywaysweakwealweanwearwebswedsweedweekweelweenweepweerweesweetweftweirwekaweldwellweltwendwenswentweptwerewertwestwetswhamwhapwhatwheewhenwhetwhewwheywhidwhigwhimwhinwhipwhirwhitwhizwhoawhomwhopwhyswichwickwidewifewigswildwilewillwiltwilywimpwindwinewingwinkwinowinswinywipewirewirywisewishwispwisswistwitewithwitswivewoadwoeswogswokewokswoldwolfwombwonkwonswontwoodwoofwoolwooswopswordworeworkwormwornwortwostwotswovewowswrapwrenwritwusswychwyeswylewyndwynnwynswyte