8-Letter Words Ending in H
408 8-letter words end in H, including research, although, approach, strength. All are playable in Scrabble-style games and useful for Wordle endings.
Highest scoring
- mezuzoth31
- tzitzith29
- chutzpah27
- jackfish27
- quackish26
- mitzvoth25
- kaffiyeh24
- keffiyeh24
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list408
acrolithactorishadmonishaerolithagallochairbrushaircoachallopathalthoughamaranthanaglyphapproachastonishbacklashbackrushbackwashbadmouthbairnishbakshishbedrenchbegorrahbehemothbequeathbescorchbesmirchbesmoothbigmouthbillfishbirdbathbirrotchblackishblandishbleakishblimpishblockishblondishblowfishbluefishboarfishbonefishbrackishbrainishbrandishbrassishbrattishbroadishbroguishbrownishbullrushcabbalahcalabashcalipashcarritchcartouchcavefishcenotaphceorlishchallothcheapishchildishchurlishchutzpahclannishclerkishcliquishcloddishclownishclubbishclumpishcoalfishcopperahcoronachcrankishcrawfishcrayfishcromlechdahabeahdahabiahdahabiehdandyishdealfishdemolishdepolishdespatchdevilishdiagraphdiminishdispatchdogteethdogtoothdogwatchdowdyishdownwashdraffishdreggishdrumfishdwarfisheldritcheleventhencroachenravishensheathentrenchepigraphetherishethnarcheurybatheyeteetheyetoothfaintishfallfishfeeblishfeverishfiendishfiftiethfiftyishfilefishflatfishflattishflatwashflourishfoolfishfootbathfootpathforsoothfortiethfortyishfreakishfrogfishfrumpishfurloughgalabiehghoulishgoatfishgoldfishgrayfishgreenishgruffishgrumpishgunsmithgypsyishhabdalahhaftarahhaftorahhaggadahhalakothharrumphhasheeshhavdalahhawfinchhawkmothheadfishhelminthheptarchherewithhiccoughhierarchhighbushhipparchhosannahhyacinthhydranthingrowthinsheathinsomuchintrenchisographisomorphisoplethjackfishjingoishkabbalahkaffiyehkashruthkeffiyehkeypunchkingfishkreplachkryolithladyfishlanguishlemonishlightishlionfishlittlishliverishlogomachlumpfishlungfishmastabahmegalithmegillahmeshugahmezuzothmidmonthmidwatchmilkfishmisfaithmishmashmishmoshmismatchmispatchmisteachmistouchmistruthmitsvothmitzvothmonkfishmonolithmonteithmoonfishmusquashmyographnabobishnargilehneomorphninnyishnonesuchnontruthnumbfishnuthatchodographoilclotholigarchomniarchorangishoutbitchoutblushoutcatchoutcoachoutlaughoutmarchoutmatchoutpitchoutpunchoutreachoutwatchoutweighoverarchoverfishoverhighoverlushovermuchoverrashoverrichpadishahpaganishparashahparfleshparritchpearlashpentarchperianthpipefishpixieishplumpishpolymathpoortithpotlatchprankishprecrashprelunchprepunchpriggishpuppyishpurplishpygmyishquackishqualmishqueerishquippishquirkishrainwashreattachrebranchrefinishregolithregrowthrelaunchrepolishreproachresearchresketchresmoothrestitchretrenchrockfishroorbachrosebushrosefishroughishroundishrowdyishsaganashsailfishsaltbushsandfishsandwichsavannahsawteethsawtoothscampishscrootchseabeachseecatchselcouthsemihighshadbushshadrachshammashsheepishshofrothshortishshrewishsissyishsixtiethsixtyishskirmishskittishslapdashslobbishsluggishsluttishsmallishsnappishsniffishsnobbishsnoutishsnowbushsparkishspookishsquarishsquirishstablishstandishstarfishsteepishstiffishstockishstoutishstramashstrengthstudfishsubepochsubgraphsuckfishsunporchsurffishswainishswampishsweetishsylphishtaiglachtarbooshteiglachtelepathtetrarchthickishthievishthinnishthoroughthuggishticklishtigerishtilefishtinsmithtoadfishtoadyishtolboothtopnotchtoughishtovarichtovarishtrampishtribrachtrickishtriglyphtrigraphtrimorphtriptychtristichtzitzithumteenthunbreechunchurchunclenchunclinchunmodishunstitchupgrowthvanquishvaporishverandahvermouthvigorishviperishvixenishwarmouthwaterishweakfishwhiplashwolffishwomanishxenolithyeshivahyokelishyoungishzoomorph