Skip to content

Word lists

8-Letter Words Ending in H

408 8-letter words end in H, including research, although, approach, strength. All are playable in Scrabble-style games and useful for Wordle endings.

Highest scoring

  • mezuzoth31
  • tzitzith29
  • chutzpah27
  • jackfish27
  • quackish26
  • mitzvoth25
  • kaffiyeh24
  • keffiyeh24

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list408

acrolithactorishadmonishaerolithagallochairbrushaircoachallopathalthoughamaranthanaglyphapproachastonishbacklashbackrushbackwashbadmouthbairnishbakshishbedrenchbegorrahbehemothbequeathbescorchbesmirchbesmoothbigmouthbillfishbirdbathbirrotchblackishblandishbleakishblimpishblockishblondishblowfishbluefishboarfishbonefishbrackishbrainishbrandishbrassishbrattishbroadishbroguishbrownishbullrushcabbalahcalabashcalipashcarritchcartouchcavefishcenotaphceorlishchallothcheapishchildishchurlishchutzpahclannishclerkishcliquishcloddishclownishclubbishclumpishcoalfishcopperahcoronachcrankishcrawfishcrayfishcromlechdahabeahdahabiahdahabiehdandyishdealfishdemolishdepolishdespatchdevilishdiagraphdiminishdispatchdogteethdogtoothdogwatchdowdyishdownwashdraffishdreggishdrumfishdwarfisheldritcheleventhencroachenravishensheathentrenchepigraphetherishethnarcheurybatheyeteetheyetoothfaintishfallfishfeeblishfeverishfiendishfiftiethfiftyishfilefishflatfishflattishflatwashflourishfoolfishfootbathfootpathforsoothfortiethfortyishfreakishfrogfishfrumpishfurloughgalabiehghoulishgoatfishgoldfishgrayfishgreenishgruffishgrumpishgunsmithgypsyishhabdalahhaftarahhaftorahhaggadahhalakothharrumphhasheeshhavdalahhawfinchhawkmothheadfishhelminthheptarchherewithhiccoughhierarchhighbushhipparchhosannahhyacinthhydranthingrowthinsheathinsomuchintrenchisographisomorphisoplethjackfishjingoishkabbalahkaffiyehkashruthkeffiyehkeypunchkingfishkreplachkryolithladyfishlanguishlemonishlightishlionfishlittlishliverishlogomachlumpfishlungfishmastabahmegalithmegillahmeshugahmezuzothmidmonthmidwatchmilkfishmisfaithmishmashmishmoshmismatchmispatchmisteachmistouchmistruthmitsvothmitzvothmonkfishmonolithmonteithmoonfishmusquashmyographnabobishnargilehneomorphninnyishnonesuchnontruthnumbfishnuthatchodographoilclotholigarchomniarchorangishoutbitchoutblushoutcatchoutcoachoutlaughoutmarchoutmatchoutpitchoutpunchoutreachoutwatchoutweighoverarchoverfishoverhighoverlushovermuchoverrashoverrichpadishahpaganishparashahparfleshparritchpearlashpentarchperianthpipefishpixieishplumpishpolymathpoortithpotlatchprankishprecrashprelunchprepunchpriggishpuppyishpurplishpygmyishquackishqualmishqueerishquippishquirkishrainwashreattachrebranchrefinishregolithregrowthrelaunchrepolishreproachresearchresketchresmoothrestitchretrenchrockfishroorbachrosebushrosefishroughishroundishrowdyishsaganashsailfishsaltbushsandfishsandwichsavannahsawteethsawtoothscampishscrootchseabeachseecatchselcouthsemihighshadbushshadrachshammashsheepishshofrothshortishshrewishsissyishsixtiethsixtyishskirmishskittishslapdashslobbishsluggishsluttishsmallishsnappishsniffishsnobbishsnoutishsnowbushsparkishspookishsquarishsquirishstablishstandishstarfishsteepishstiffishstockishstoutishstramashstrengthstudfishsubepochsubgraphsuckfishsunporchsurffishswainishswampishsweetishsylphishtaiglachtarbooshteiglachtelepathtetrarchthickishthievishthinnishthoroughthuggishticklishtigerishtilefishtinsmithtoadfishtoadyishtolboothtopnotchtoughishtovarichtovarishtrampishtribrachtrickishtriglyphtrigraphtrimorphtriptychtristichtzitzithumteenthunbreechunchurchunclenchunclinchunmodishunstitchupgrowthvanquishvaporishverandahvermouthvigorishviperishvixenishwarmouthwaterishweakfishwhiplashwolffishwomanishxenolithyeshivahyokelishyoungishzoomorph