Skip to content

Word lists

8-Letter Words Ending in Y

1,711 8-letter words end in Y, including actually, probably, military, security. All are playable in Scrabble-style games and useful for Wordle endings.

Highest scoring

  • frizzily32
  • kolkhozy31
  • sovkhozy30
  • kazatsky28
  • hokypoky27
  • janizary27
  • quixotry27
  • schmalzy27

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list1,711

abasedlyabeyancyabjectlyaborallyabruptlyabsentlyabsurdlyaccuracyacerbityachinglyacridityacrimonyactivelyactivityactressyactuallyadamancyadditoryadequacyadorablyadroitlyadulteryadvisoryadvocacyaeriallyaerologyaeronomyaffinelyaffinityagrimonyagrologyagronomyaguishlyaimfullyaislewayalacrityalderflyaleatoryalgidityalgologyalkalifyallegoryalleywayallogamyallotypyalmightyalpinelyamazedlyamenablyamicablyammonifyamorallyamusedlyancestryanimallyannuallyanodallyantibodyanticityantilogyantimonyantinomyantonymyapicallyapiologyapocarpyapophonyapoplexyaposporyapostacyapostasyardentlyareologyarguablyarrantlyartfullyartistryasperityassemblyastrallyastutelyathanasyatonallyatrocityattorneyaudacityauditoryaugustlyautarchyautogamyautogenyautonomyautotomyautotypyaverselyavowablyavowedlyaxialityaxillaryaxiologybackstaybadgerlyballadrybanalitybanditrybankerlybarberrybarratrybarrenlybarretrybasicitybasilarybasketrybastardybayberrybeachboybearablybeautifybeggarlybenignlybestiarybiasedlybiddablybifiditybigeminybihourlybilberrybinatelybioassaybiometrybioscopybirthdaybistourybitcherybitchilybitinglybitterlybiweeklybiyearlyblackboyblackflybladderyblamablyblatancyblazonryblearilyblisteryblithelybloodilybloomeryblossomyblousilyblowsilyblowzilyblubberyblurrilyblusterybodinglyboringlybotcherybotchilybottomryboulderybouncilyboundarybovinelybovinitybowinglyboxberryboyishlybrainilybrassilybrawnilybrazenlybreezilybrevetcybreviarybridallybrightlybroguerybroiderybrokenlybroodilybrutallybryologybuccallybullockybullyboybunchilybuoyancyburglaryburgundybusybodybutcherycablewaycaducitycaecallycajolerycalamarycalamitycandidlycaninitycannonrycapacitycarnallycartoonycastawaycasuallycasualtycatchflycategorycatenarycaudallycausallycausewaycavitaryceleritycelibacycemeterycentauryceremonycetologychambraychancerychancilycharladychastelychastitychatterychattilycheekilycheerilycheesilychemurgychiccorychickorychillilychimbleychirpilychirrupychivalrychoicelychoirboychoppilychorallychronaxychubbilychummilychunkilychurchlycinerarycircuitycitatorycivilityclammilyclassifyclassilyclatteryclemencycleverlyclinallyclonallycloudilyclowneryclumsilyclusteryclutterycoagencycoarselycobwebbycoembodycoemploycoevallycogentlycoitallycollierycolloquycolotomycomelilycometarycommonlyconicitycontraryconvexlycooinglycopurifycoquetrycorduroycornetcycoronarycorsetrycostmarycostumeycottageycourtesycousinlycousinrycovertlycowardlycowberrycrabbilycraftilycraggilycramoisycrankilycravenlycrawlwaycreakilycreamerycreamilycrediblycreepilycrispilycroakilycrockerycrookerycrosswaycroupilycrouselycrustilycryinglycryogenycubicityculinaryculpablycupiditycurrencycurrierycursedlycurvedlycushionycussedlycustardycutcherycycliclycymoselycytogenycytologydaintilydamnablydapperlydaringlydativelydeaconrydebilitydecenarydecentlydelegacydelicacydeliverydelusorydemagogydemurelydenazifydeniablydentallyderisorydetoxifydeucedlydeviancydeviltrydevoutlydewberrydiablerydiaphonydidynamydilatorydiploidydirectlydisarraydismallydistallydisunitydivinelydivinitydocilelydocilitydogberrydoggedlydogsbodydomesdaydoomsdaydormancydorsallydotardlydotinglydoughboydownplaydoxologydraftilydraughtydreamilydrearilydressilydrivewaydrollerydroopilydroughtydrowsilydrudgerydudishlydulcetlyduopsonydyspepsyearthilyeasterlyeffetelyefficacyeighthlyelatedlyelegancyelfishlyeligiblyelvishlyeminencyemissaryemulsifyenactoryendarchyendogamyendogenyengineryenormityensigncyenthalpyentirelyentiretyentreatyentrywayenviablyepicallyepilepsyepinastyepiphanyepistasyepizootyequalityequinelyequinityerrantlyerrantryerringlyesterifyeternityetherifyethologyetiologyeuphrasyeuploidyeurythmyeutrophyeverydayeverywayexigencyexiguityexpertlyfacetelyfaciallyfacilelyfacilityfadeawayfaggotryfalconryfallawayfalliblyfamouslyfarrieryfatalityfatherlyfaultilyfaunallyfeasiblyfeatheryfederacyfelicityfelinelyfelinityfellowlyfeminacyfeminityferacityferetoryferocityfervencyfervidlyfestallyfetologyfeudallyfidelityfiercelyfiliallyfilthilyfinalityfinitelyfinnickyfireclayfiscallyfitfullyflabbilyflackeryflashilyflatteryflavouryfleecilyflexiblyflickeryflimsilyflintilyfloodwayfloppilyflorallyfloridlyflossilyfluentlyfluffilyfluidityflummeryflutteryfoldawayfolksilyforcedlyforciblyforebodyforeladyforeplayforestayforestryforkedlyformallyformerlyfortuityfourthlyfreakilyfrenzilyfriendlyfrigidlyfripperyfriskilyfrizzilyfrolickyfromentyfrostilyfrothilyfrowzilyfrozenlyfructifyfrugallyfruitilyfrumentyfrumpilyfugacityfumatoryfuminglyfumitoryfuneraryfurmentyfurrieryfutilelyfutilityfuturitygadgetrygapinglygarganeygarishlygarlickygauchelygeliditygemologygeniallygentrifygeognosygeomancygeometrygeophagygibinglygiftedlygimmickygingeleygingellygingerlygiveawayglassilyglazieryglitterygloballygloomilyglossaryglossilyglumpilygluttonygoldenlygorbellygorblimygorgedlygossiprygramercygrassilygratuitygravellygravidlygreasilygreedilygreenerygreenflygreenwaygrinderygrittilygroggerygroggilygrubbilygruffilygrumpilyguarantyguernseyguidewayguiltilygullablygulliblygulositygynandrygynarchygyniatrygyratoryhagberryhaploidyharlotryhatcheryhatchwayheadachyheadstayheartilyheatedlyheatheryheavenlyhecticlyhegemonyhegumenyhelicityheraldryhereawayheredityhermitryherstoryhexapodyhexarchyhiddenlyhideawayhilarityhillockyhoarselyhogmanayhogmenayhokypokyhollowlyhologamyhologynyhomebodyhomestayhomogamyhomogenyhomogonyhomologyhomonymyhonestlyhonoraryhorologyhorriblyhorridlyhorseflyhostelryhouseboyhouseflyhumanelyhumanityhumidifyhumidityhumilityhummockyhungrilyhuntedlyhushedlyhydropsyhypogynyidealityidealogyidentifyidentityideologyidolatryidoneityignominyillusoryimmunityimparityimpishlyimpolicyimpunityimpurelyimpurityincisoryindignlyindustryinequityinfantryinfinityinfirmlyiniquityinkberryinnatelyinsanelyinsanityinstancyintentlyinterlayintimacyintradayinverityinviablyinwardlyionicityirefullyisocracyisometryisosporyisostasyisotropyissuablyjackstayjadishlyjaggedlyjaggheryjanisaryjanizaryjapinglyjauntilyjealousyjejunelyjejunityjeopardyjesuitryjibinglyjocoselyjocosityjocundlyjokinglyjoviallyjovialtyjoyfullyjoyouslyjuggleryjuratorykazatskykielbasykissablyknackeryknightlyknottilykolinskykolkhosykolkhozylabiallylabilitylackadaylacunarylaicallylamaserylambencylaminarylandladylanositylapidarylapidifylatchkeylatentlylatinitylatterlylaudablylavatorylavishlylawfullylawyerlyleadenlyleatherylegalitylegendrylegerityleniencylethallylethargylienterylimberlylimitarylimpidlylineallylinearlyliquidlylissomlyliteracyliterarylivelilylividitylivinglylobatelyloblollylobotomylocalitylocutorylogotypylonelilylosinglyloveablylovelilylovinglylubberlylucentlylucidityluminarylunatelylyratelylysogenymaccaboymaccoboymahoganymaidenlymainstaymajoritymalarkeymalignlymanfullymangabeymannerlymanuallymarkedlymartyrlymassedlymasterlymatronlymattedlymaturelymaturitymaumetrymeagerlymeagrelymediallymedianlymegacitymellowlymeniallymenologymentallymesiallymesnaltymetonymymicrurgymidstorymightilymilitarymilliaryminacityminatoryministryminorityminutelymisandrymisapplymisassaymiscarrymisentrymisogamymisogynymisologymissilrymixologymobilitymodalitymodernlymodestlymodishlymolalitymolaritymoltenlymomentlymonandrymonarchymonetarymonitorymonogamymonogenymonogynymonologymonopodymonopolymonosomymonotonymopinglymopishlymoralitymoratorymorbidlymordancymoronitymoroselymorositymortallymortuarymotherlymotilitymotivitymotorwaymouthilymoveablymovinglymuciditymucositymudpuppymulberrymulishlymullockymultiplymusinglymusketrymustardymutuallymycologymyopathymysticlynaboberynarrowlynasalitynascencynatalitynatantlynatatorynativelynativitynaumachynebbishynecropsyneurallynihilitynitpickynobilitynodalitynodositynomarchynomologynondairynonemptynonentrynonfattynonhardynonleafynonmoneynonpartynonstorynonwoodynormalcynormallynosologynounallynubilitynugatorynumeracynumeraryoafishlyobduracyobituaryoblatelyoblatoryoblonglyobtuselyobtusityoccultlyoctarchyoctonaryocularlyodiouslyodometryoecologyoenologyoffishlyogrishlyoinologyomophagyoncologyontogenyontologyopaquelyoperablyopsonifyopulencyorangeryordinaryornatelyorthoepyotioselyotiosityotoscopyoutbullyoutlawryoutstudyoutwearyoverbusyovereasyoverholyovermanyoverplayoverstayoverwaryoverwilyowlishlypaduasoypalimonypallidlypalpablypaltrilypandowdypansophypaperboypapistrypassablypasserbypatchilypatentlypatronlypeacockypeccancypedagogypedantrypedatelypeddlerypedologypenalitypendencypenologyperigynyperipetyperspirypetalodypettedlyphantasypharmacyphyllarypicnickypilositypipinglypiquancypitchilypitiablyplacablyplacidlyplagiaryplaguilyplasterypleurisypliantlypluckilypluguglyplumberyplurallyplushilyplyinglypodiatrypolaritypolitelypolygamypolygonypolygynypolyparypolypodypolysemypolytenypomologypopinjaypopishlyporosityporouslyporphyryporridgyportablyposinglyposologypossiblypostallypotatorypotbellypotentlypreppilyprettifyprettilypriestlypriggeryprincelyprinterypriorityprissilyprobablyprolixlypromptlyproperlypropertyprophecyprophesyprovablyprovenlypryinglypsalmodypsalterypubliclypulinglypulpallypunchilypunditrypungencypunitorypupilarypuppetryputridlypyrologyquackeryquagmiryquaintlyquandaryquantifyquantityqueasilyquiddityquirkilyquixotryquotablyrabbitryrabidityraciallyradiallyradiancyraggedlyraginglyrailleryrakishlyramoselyramosityrampancyrancidlyrandomlyrapacityrapidityrascallyrateablyravinglyreadablyreaderlyrecentlyrecodifyreconveyrecoveryrectallyredeployreembodyreemployrefineryreflexlyregalityregistryregnancyreinjuryreliablyremisslyremodifyremotelyrenotifyreoccupyrepacifyrepandlyrepurifyresinifyresupplyresurveyretrallyreverifyrevisoryrevivifyrhapsodyrheologyribaldlyribaldryrigidifyrigidityrimoselyrimosityrituallyrobustlyrockawayrocketryrogatoryrollawayrollickyrosemaryrotatoryrottenlyrotundlyroughdryroutewayrovinglyrubbishyruefullyruggedlyrugoselyrugosityruralityrusticlysacredlysacristysaddlerysagacitysailorlysalacitysaleablysaliencysalinitysalivarysallowlysalutarysalvablysanctifysanctitysanitarysapiditysapiencysaponifysatiablysavagelysavagerysavinglysavorilyscabbilyscalablyscammonyscantilyscarcelyscarcityschlockyschmalzyscrabblyscragglyscratchyscreechyscroungyscrutinysculleryscurvilyseamanlysecantlysecondlysecretlysecundlysecurelysecuritysedatelysedulityseignoryseldomlyselectlyseminarysenilelysenilitysensiblysequencyserenelyserenityseriallyserologyserosityseverelyseveritysexologysextuplysexuallyshabbilyshaggilyshiftilyshimmeryshinneryshmaltzyshoddilyshrewdlyshudderysickerlysicklilysignallysigniorysilentlysilicifysilverlysimplifysinfullysinologysisterlysitologysixpennysizeablyskimpilyskitteryslabberyslangilysleazilysleepilyslidewayslightlyslinkilyslipperyslitheryslobberysloppilyslovenlyslumberyslushilysmarmilysmelterysmitherysmoothlysmotherysmudgilysmuttilysnappilysneakilysnickerysniffilysnippetysnippilysnobberysnobbilysnoopilysnootilysnottilysnuffilysnuggerysobrietysociablysociallysodalitysoddenlysoldierysolemnlysolidarysolidifysoliditysolitarysolvencysomberlysombrelysomebodysonobuoysonoritysoothsaysordidlysororitysortablysovkhozysovranlysovrantysowbellysparkilysparselysparsityspeedilyspeedwayspermaryspiffilyspillwayspinachyspinallyspinneryspirallysplotchyspongilyspooferyspookeryspookilyspoonilysportilyspottilysprucelyspunkilysquarelysquelchysquigglysquooshystaggerystairwaystalkilystanchlystannarystatedlystatickystatuarysteadilystealthysteamilystellifystemmerysternwaystickilystingilystingraystockilystodgilystolidlystomachystoneflystormilystowawaystragglystraitlystramonystrategystratifystretchystrictlystronglystubbilystuffilystultifystupidlysturdilysubentrysubtiltysubtletysudatorysuddenlysuitablysullenlysulphurysultrilysummerlysummitrysunbeamysunshinysuperblysuperlaysuperspysupinelysupplelysveltelyswankilyswannerysweatilyswimmilysymmetrysympathysympatrysymphonysyncarpysynonymytabooleytakeawaytakinglytangencytangiblytanistrytapestrytarnallytawdrilytaxinglytaxonomyteaberrytearawaytelegonyteleplaytemeritytenacitytenantrytendencytenderlytenotomytenpennytensiblytepidityterriblytertiarytetchilytextuarythatawaythearchytheodicytheogonytheologytheonomythicketythieverythornilythrawnlythrenodythuggerythunderythwartlytimiditytinsellytittuppytitularytocologytoiletrytokologytomalleytomatoeytonalitytonicitytonishlytoothilytoploftytopologytoponymytorositytorpidlytorridlytotalitytouchilytouristytowardlytoxicitytrackwaytrainwaytrashilytravestytreasurytrendilytriarchytriballytrickerytrickilytriunitytrollopytruantrytrumperytrustilytryinglytumiditytuneablytuppennyturbidlyturgencyturgidlytussockytutelarytwitterytwopennytypologyubiquityudometryultimacyultradryunbloodyunbouncyuncatchyunchancyunchiclyunciallyuncomelyunderbuyunderlayunderpayunderwayuneasilyunevenlyunfairlyunflashyungainlyungentlyungreedyunholilyuniquelyunitedlyunjustlyunkindlyunkinglyunlikelyunlivelyunlovelyunmeetlyunprettyunreallyunripelyunsafelyunsafetyunsavoryunseemlyunstablyunsteadyunstuffyunsubtlyunsurelyuntidilyuntimelyuntrendyuntrustyunwarilyunwieldyunwifelyunwiselyunworthyuppishlyupwardlyurbanelyurbanityurgentlyurginglyuroscopyusefullyuvularlyvacantlyvagilityvagotomyvagrancyvaliancyvalidityvaluablyvanitoryvapidityvariablyvariedlyvarletryvarnishyvasotomyveiledlyvelleityvelocityvenalityvendiblyveniallyvenosityvenouslyveracityverballyverdancyvernallyvespiaryvestallyvestiaryvexinglyvibrancyvicenaryvicinityvillainyvinciblyvinegaryvinosityvinouslyviolablyviridityvirilelyvirilityvirologyviscidlyvisuallyvitalityvivacityvocalityvomitoryvoracityvotivelyvulgarlywalkawaywantonlywardenrywarrantywastewaywatchcrywaterilywaterwaywaxberryweaponryweasellyweevillywelladaywellawaywesterlywheezilywhiskerywhisperywhiteflywickedlywidthwaywilfullywingedlywinterlywintrilywitcherywizardlywizardrywoefullywontedlywoodenlywooinglywoollilywordplayworkadayworthilywrathilywriterlyxenogamyxenogenyxylotomyyeastilyyellowlyyeomanlyyeomanryzealotryzoolatryzoometryzoophilyzygosityzymology