8-Letter Words Ending in Y
1,711 8-letter words end in Y, including actually, probably, military, security. All are playable in Scrabble-style games and useful for Wordle endings.
Highest scoring
- frizzily32
- kolkhozy31
- sovkhozy30
- kazatsky28
- hokypoky27
- janizary27
- quixotry27
- schmalzy27
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list1,711
abasedlyabeyancyabjectlyaborallyabruptlyabsentlyabsurdlyaccuracyacerbityachinglyacridityacrimonyactivelyactivityactressyactuallyadamancyadditoryadequacyadorablyadroitlyadulteryadvisoryadvocacyaeriallyaerologyaeronomyaffinelyaffinityagrimonyagrologyagronomyaguishlyaimfullyaislewayalacrityalderflyaleatoryalgidityalgologyalkalifyallegoryalleywayallogamyallotypyalmightyalpinelyamazedlyamenablyamicablyammonifyamorallyamusedlyancestryanimallyannuallyanodallyantibodyanticityantilogyantimonyantinomyantonymyapicallyapiologyapocarpyapophonyapoplexyaposporyapostacyapostasyardentlyareologyarguablyarrantlyartfullyartistryasperityassemblyastrallyastutelyathanasyatonallyatrocityattorneyaudacityauditoryaugustlyautarchyautogamyautogenyautonomyautotomyautotypyaverselyavowablyavowedlyaxialityaxillaryaxiologybackstaybadgerlyballadrybanalitybanditrybankerlybarberrybarratrybarrenlybarretrybasicitybasilarybasketrybastardybayberrybeachboybearablybeautifybeggarlybenignlybestiarybiasedlybiddablybifiditybigeminybihourlybilberrybinatelybioassaybiometrybioscopybirthdaybistourybitcherybitchilybitinglybitterlybiweeklybiyearlyblackboyblackflybladderyblamablyblatancyblazonryblearilyblisteryblithelybloodilybloomeryblossomyblousilyblowsilyblowzilyblubberyblurrilyblusterybodinglyboringlybotcherybotchilybottomryboulderybouncilyboundarybovinelybovinitybowinglyboxberryboyishlybrainilybrassilybrawnilybrazenlybreezilybrevetcybreviarybridallybrightlybroguerybroiderybrokenlybroodilybrutallybryologybuccallybullockybullyboybunchilybuoyancyburglaryburgundybusybodybutcherycablewaycaducitycaecallycajolerycalamarycalamitycandidlycaninitycannonrycapacitycarnallycartoonycastawaycasuallycasualtycatchflycategorycatenarycaudallycausallycausewaycavitaryceleritycelibacycemeterycentauryceremonycetologychambraychancerychancilycharladychastelychastitychatterychattilycheekilycheerilycheesilychemurgychiccorychickorychillilychimbleychirpilychirrupychivalrychoicelychoirboychoppilychorallychronaxychubbilychummilychunkilychurchlycinerarycircuitycitatorycivilityclammilyclassifyclassilyclatteryclemencycleverlyclinallyclonallycloudilyclowneryclumsilyclusteryclutterycoagencycoarselycobwebbycoembodycoemploycoevallycogentlycoitallycollierycolloquycolotomycomelilycometarycommonlyconicitycontraryconvexlycooinglycopurifycoquetrycorduroycornetcycoronarycorsetrycostmarycostumeycottageycourtesycousinlycousinrycovertlycowardlycowberrycrabbilycraftilycraggilycramoisycrankilycravenlycrawlwaycreakilycreamerycreamilycrediblycreepilycrispilycroakilycrockerycrookerycrosswaycroupilycrouselycrustilycryinglycryogenycubicityculinaryculpablycupiditycurrencycurrierycursedlycurvedlycushionycussedlycustardycutcherycycliclycymoselycytogenycytologydaintilydamnablydapperlydaringlydativelydeaconrydebilitydecenarydecentlydelegacydelicacydeliverydelusorydemagogydemurelydenazifydeniablydentallyderisorydetoxifydeucedlydeviancydeviltrydevoutlydewberrydiablerydiaphonydidynamydilatorydiploidydirectlydisarraydismallydistallydisunitydivinelydivinitydocilelydocilitydogberrydoggedlydogsbodydomesdaydoomsdaydormancydorsallydotardlydotinglydoughboydownplaydoxologydraftilydraughtydreamilydrearilydressilydrivewaydrollerydroopilydroughtydrowsilydrudgerydudishlydulcetlyduopsonydyspepsyearthilyeasterlyeffetelyefficacyeighthlyelatedlyelegancyelfishlyeligiblyelvishlyeminencyemissaryemulsifyenactoryendarchyendogamyendogenyengineryenormityensigncyenthalpyentirelyentiretyentreatyentrywayenviablyepicallyepilepsyepinastyepiphanyepistasyepizootyequalityequinelyequinityerrantlyerrantryerringlyesterifyeternityetherifyethologyetiologyeuphrasyeuploidyeurythmyeutrophyeverydayeverywayexigencyexiguityexpertlyfacetelyfaciallyfacilelyfacilityfadeawayfaggotryfalconryfallawayfalliblyfamouslyfarrieryfatalityfatherlyfaultilyfaunallyfeasiblyfeatheryfederacyfelicityfelinelyfelinityfellowlyfeminacyfeminityferacityferetoryferocityfervencyfervidlyfestallyfetologyfeudallyfidelityfiercelyfiliallyfilthilyfinalityfinitelyfinnickyfireclayfiscallyfitfullyflabbilyflackeryflashilyflatteryflavouryfleecilyflexiblyflickeryflimsilyflintilyfloodwayfloppilyflorallyfloridlyflossilyfluentlyfluffilyfluidityflummeryflutteryfoldawayfolksilyforcedlyforciblyforebodyforeladyforeplayforestayforestryforkedlyformallyformerlyfortuityfourthlyfreakilyfrenzilyfriendlyfrigidlyfripperyfriskilyfrizzilyfrolickyfromentyfrostilyfrothilyfrowzilyfrozenlyfructifyfrugallyfruitilyfrumentyfrumpilyfugacityfumatoryfuminglyfumitoryfuneraryfurmentyfurrieryfutilelyfutilityfuturitygadgetrygapinglygarganeygarishlygarlickygauchelygeliditygemologygeniallygentrifygeognosygeomancygeometrygeophagygibinglygiftedlygimmickygingeleygingellygingerlygiveawayglassilyglazieryglitterygloballygloomilyglossaryglossilyglumpilygluttonygoldenlygorbellygorblimygorgedlygossiprygramercygrassilygratuitygravellygravidlygreasilygreedilygreenerygreenflygreenwaygrinderygrittilygroggerygroggilygrubbilygruffilygrumpilyguarantyguernseyguidewayguiltilygullablygulliblygulositygynandrygynarchygyniatrygyratoryhagberryhaploidyharlotryhatcheryhatchwayheadachyheadstayheartilyheatedlyheatheryheavenlyhecticlyhegemonyhegumenyhelicityheraldryhereawayheredityhermitryherstoryhexapodyhexarchyhiddenlyhideawayhilarityhillockyhoarselyhogmanayhogmenayhokypokyhollowlyhologamyhologynyhomebodyhomestayhomogamyhomogenyhomogonyhomologyhomonymyhonestlyhonoraryhorologyhorriblyhorridlyhorseflyhostelryhouseboyhouseflyhumanelyhumanityhumidifyhumidityhumilityhummockyhungrilyhuntedlyhushedlyhydropsyhypogynyidealityidealogyidentifyidentityideologyidolatryidoneityignominyillusoryimmunityimparityimpishlyimpolicyimpunityimpurelyimpurityincisoryindignlyindustryinequityinfantryinfinityinfirmlyiniquityinkberryinnatelyinsanelyinsanityinstancyintentlyinterlayintimacyintradayinverityinviablyinwardlyionicityirefullyisocracyisometryisosporyisostasyisotropyissuablyjackstayjadishlyjaggedlyjaggheryjanisaryjanizaryjapinglyjauntilyjealousyjejunelyjejunityjeopardyjesuitryjibinglyjocoselyjocosityjocundlyjokinglyjoviallyjovialtyjoyfullyjoyouslyjuggleryjuratorykazatskykielbasykissablyknackeryknightlyknottilykolinskykolkhosykolkhozylabiallylabilitylackadaylacunarylaicallylamaserylambencylaminarylandladylanositylapidarylapidifylatchkeylatentlylatinitylatterlylaudablylavatorylavishlylawfullylawyerlyleadenlyleatherylegalitylegendrylegerityleniencylethallylethargylienterylimberlylimitarylimpidlylineallylinearlyliquidlylissomlyliteracyliterarylivelilylividitylivinglylobatelyloblollylobotomylocalitylocutorylogotypylonelilylosinglyloveablylovelilylovinglylubberlylucentlylucidityluminarylunatelylyratelylysogenymaccaboymaccoboymahoganymaidenlymainstaymajoritymalarkeymalignlymanfullymangabeymannerlymanuallymarkedlymartyrlymassedlymasterlymatronlymattedlymaturelymaturitymaumetrymeagerlymeagrelymediallymedianlymegacitymellowlymeniallymenologymentallymesiallymesnaltymetonymymicrurgymidstorymightilymilitarymilliaryminacityminatoryministryminorityminutelymisandrymisapplymisassaymiscarrymisentrymisogamymisogynymisologymissilrymixologymobilitymodalitymodernlymodestlymodishlymolalitymolaritymoltenlymomentlymonandrymonarchymonetarymonitorymonogamymonogenymonogynymonologymonopodymonopolymonosomymonotonymopinglymopishlymoralitymoratorymorbidlymordancymoronitymoroselymorositymortallymortuarymotherlymotilitymotivitymotorwaymouthilymoveablymovinglymuciditymucositymudpuppymulberrymulishlymullockymultiplymusinglymusketrymustardymutuallymycologymyopathymysticlynaboberynarrowlynasalitynascencynatalitynatantlynatatorynativelynativitynaumachynebbishynecropsyneurallynihilitynitpickynobilitynodalitynodositynomarchynomologynondairynonemptynonentrynonfattynonhardynonleafynonmoneynonpartynonstorynonwoodynormalcynormallynosologynounallynubilitynugatorynumeracynumeraryoafishlyobduracyobituaryoblatelyoblatoryoblonglyobtuselyobtusityoccultlyoctarchyoctonaryocularlyodiouslyodometryoecologyoenologyoffishlyogrishlyoinologyomophagyoncologyontogenyontologyopaquelyoperablyopsonifyopulencyorangeryordinaryornatelyorthoepyotioselyotiosityotoscopyoutbullyoutlawryoutstudyoutwearyoverbusyovereasyoverholyovermanyoverplayoverstayoverwaryoverwilyowlishlypaduasoypalimonypallidlypalpablypaltrilypandowdypansophypaperboypapistrypassablypasserbypatchilypatentlypatronlypeacockypeccancypedagogypedantrypedatelypeddlerypedologypenalitypendencypenologyperigynyperipetyperspirypetalodypettedlyphantasypharmacyphyllarypicnickypilositypipinglypiquancypitchilypitiablyplacablyplacidlyplagiaryplaguilyplasterypleurisypliantlypluckilypluguglyplumberyplurallyplushilyplyinglypodiatrypolaritypolitelypolygamypolygonypolygynypolyparypolypodypolysemypolytenypomologypopinjaypopishlyporosityporouslyporphyryporridgyportablyposinglyposologypossiblypostallypotatorypotbellypotentlypreppilyprettifyprettilypriestlypriggeryprincelyprinterypriorityprissilyprobablyprolixlypromptlyproperlypropertyprophecyprophesyprovablyprovenlypryinglypsalmodypsalterypubliclypulinglypulpallypunchilypunditrypungencypunitorypupilarypuppetryputridlypyrologyquackeryquagmiryquaintlyquandaryquantifyquantityqueasilyquiddityquirkilyquixotryquotablyrabbitryrabidityraciallyradiallyradiancyraggedlyraginglyrailleryrakishlyramoselyramosityrampancyrancidlyrandomlyrapacityrapidityrascallyrateablyravinglyreadablyreaderlyrecentlyrecodifyreconveyrecoveryrectallyredeployreembodyreemployrefineryreflexlyregalityregistryregnancyreinjuryreliablyremisslyremodifyremotelyrenotifyreoccupyrepacifyrepandlyrepurifyresinifyresupplyresurveyretrallyreverifyrevisoryrevivifyrhapsodyrheologyribaldlyribaldryrigidifyrigidityrimoselyrimosityrituallyrobustlyrockawayrocketryrogatoryrollawayrollickyrosemaryrotatoryrottenlyrotundlyroughdryroutewayrovinglyrubbishyruefullyruggedlyrugoselyrugosityruralityrusticlysacredlysacristysaddlerysagacitysailorlysalacitysaleablysaliencysalinitysalivarysallowlysalutarysalvablysanctifysanctitysanitarysapiditysapiencysaponifysatiablysavagelysavagerysavinglysavorilyscabbilyscalablyscammonyscantilyscarcelyscarcityschlockyschmalzyscrabblyscragglyscratchyscreechyscroungyscrutinysculleryscurvilyseamanlysecantlysecondlysecretlysecundlysecurelysecuritysedatelysedulityseignoryseldomlyselectlyseminarysenilelysenilitysensiblysequencyserenelyserenityseriallyserologyserosityseverelyseveritysexologysextuplysexuallyshabbilyshaggilyshiftilyshimmeryshinneryshmaltzyshoddilyshrewdlyshudderysickerlysicklilysignallysigniorysilentlysilicifysilverlysimplifysinfullysinologysisterlysitologysixpennysizeablyskimpilyskitteryslabberyslangilysleazilysleepilyslidewayslightlyslinkilyslipperyslitheryslobberysloppilyslovenlyslumberyslushilysmarmilysmelterysmitherysmoothlysmotherysmudgilysmuttilysnappilysneakilysnickerysniffilysnippetysnippilysnobberysnobbilysnoopilysnootilysnottilysnuffilysnuggerysobrietysociablysociallysodalitysoddenlysoldierysolemnlysolidarysolidifysoliditysolitarysolvencysomberlysombrelysomebodysonobuoysonoritysoothsaysordidlysororitysortablysovkhozysovranlysovrantysowbellysparkilysparselysparsityspeedilyspeedwayspermaryspiffilyspillwayspinachyspinallyspinneryspirallysplotchyspongilyspooferyspookeryspookilyspoonilysportilyspottilysprucelyspunkilysquarelysquelchysquigglysquooshystaggerystairwaystalkilystanchlystannarystatedlystatickystatuarysteadilystealthysteamilystellifystemmerysternwaystickilystingilystingraystockilystodgilystolidlystomachystoneflystormilystowawaystragglystraitlystramonystrategystratifystretchystrictlystronglystubbilystuffilystultifystupidlysturdilysubentrysubtiltysubtletysudatorysuddenlysuitablysullenlysulphurysultrilysummerlysummitrysunbeamysunshinysuperblysuperlaysuperspysupinelysupplelysveltelyswankilyswannerysweatilyswimmilysymmetrysympathysympatrysymphonysyncarpysynonymytabooleytakeawaytakinglytangencytangiblytanistrytapestrytarnallytawdrilytaxinglytaxonomyteaberrytearawaytelegonyteleplaytemeritytenacitytenantrytendencytenderlytenotomytenpennytensiblytepidityterriblytertiarytetchilytextuarythatawaythearchytheodicytheogonytheologytheonomythicketythieverythornilythrawnlythrenodythuggerythunderythwartlytimiditytinsellytittuppytitularytocologytoiletrytokologytomalleytomatoeytonalitytonicitytonishlytoothilytoploftytopologytoponymytorositytorpidlytorridlytotalitytouchilytouristytowardlytoxicitytrackwaytrainwaytrashilytravestytreasurytrendilytriarchytriballytrickerytrickilytriunitytrollopytruantrytrumperytrustilytryinglytumiditytuneablytuppennyturbidlyturgencyturgidlytussockytutelarytwitterytwopennytypologyubiquityudometryultimacyultradryunbloodyunbouncyuncatchyunchancyunchiclyunciallyuncomelyunderbuyunderlayunderpayunderwayuneasilyunevenlyunfairlyunflashyungainlyungentlyungreedyunholilyuniquelyunitedlyunjustlyunkindlyunkinglyunlikelyunlivelyunlovelyunmeetlyunprettyunreallyunripelyunsafelyunsafetyunsavoryunseemlyunstablyunsteadyunstuffyunsubtlyunsurelyuntidilyuntimelyuntrendyuntrustyunwarilyunwieldyunwifelyunwiselyunworthyuppishlyupwardlyurbanelyurbanityurgentlyurginglyuroscopyusefullyuvularlyvacantlyvagilityvagotomyvagrancyvaliancyvalidityvaluablyvanitoryvapidityvariablyvariedlyvarletryvarnishyvasotomyveiledlyvelleityvelocityvenalityvendiblyveniallyvenosityvenouslyveracityverballyverdancyvernallyvespiaryvestallyvestiaryvexinglyvibrancyvicenaryvicinityvillainyvinciblyvinegaryvinosityvinouslyviolablyviridityvirilelyvirilityvirologyviscidlyvisuallyvitalityvivacityvocalityvomitoryvoracityvotivelyvulgarlywalkawaywantonlywardenrywarrantywastewaywatchcrywaterilywaterwaywaxberryweaponryweasellyweevillywelladaywellawaywesterlywheezilywhiskerywhisperywhiteflywickedlywidthwaywilfullywingedlywinterlywintrilywitcherywizardlywizardrywoefullywontedlywoodenlywooinglywoollilywordplayworkadayworthilywrathilywriterlyxenogamyxenogenyxylotomyyeastilyyellowlyyeomanlyyeomanryzealotryzoolatryzoometryzoophilyzygosityzymology