Words Ending in Y
12,767 English words end in Y. The most common are shown first; narrow by word length below.
Highest scoring
- quizzicality44
- quizzically43
- pizazzy39
- showbizzy38
- hypophysectomy37
- hypnotizability37
- dizzyingly36
- squeezability36
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first12,767
Showing the 300 most common of 12,767 words. The length links below give complete lists.
bymytheyonlyanywayverymayreallydaywhymanysayeveryfamilymoneyawaycityplaycompanytodayalreadytrypartyactuallycountrystoryearlyguypaybodyhistoryuniversityprettyprobablyhappycommunitystaybuyeasyreadybabystudyenergyespeciallylikelymilitarysecuritycountyindustrysorryboypolicyfinallysocietyexactlyusuallyheykeyqualitypropertyenjoytechnologysimplycurrentlycrazydailyarmyokayfunnycenturyrecentlynearlyquicklycertainlycompletelyabsolutelyimmediatelysafetyheavyabilitydefinitelyparticularlyladynobodygenerallysecretaryopportunitymajorityseriouslyclearlyanywayeasilyliterallynecessaryyesterdaygaydirectlycarryfullyhighlyrealityholytheoryprimaryeventuallytrulyagencyeconomylibraryactivityworryeverybodymostlytotallypreviouslyapplymemorysupplyauthorityhealthysomebodyobviouslyapparentlyextremelycopyluckypossiblybirthdayflybusybeautyvarietyslightlyresponsibilitydryhenryinjurylovelystrategybayvictoryskyharryplentyvalleyentirelyemergencydutycapacityenemyraysurveyattorneyhonestlysuddenlyoriginallyentryangryjerseyholidayrelativelytwentyjourneyidentityspecificallylaytonyfriendlyproperlyapproximatelyslowlydisplaysurgeryministrybasicallytinytypicallyunfortunatelyguiltylargelyassemblyperfectlymainlyfacilityterritorycryemptydeliveryrecoverypossibilitynavyweeklyacademycategorynormallypersonallyultimatelyturkeyanybodyidentifyhopefullyfrequentlyjoydirtydeputynearbysurelyfactorypersonalitywidelyheavilysignificantlyhardlycloselysecondaryconstantlyofficiallyanniversarybatterydestroyfantasytherapyregularlyautomaticallycomedydemocracyreplyfairlymonthlyjurybarelygalleryhighwayinitiallyphilosophyeffectivelycontemporarygreynaturallyprimarilytemporarynecessarilyshortlyeverydaystronglypovertyrailwaycarefullygrayhungryanxietycharitymysterypenaltydiscoveryphotographyrespectivelysuccessfullybadlyjimmykellydeeplyelectricitysexyuglynewlyhockeyrarelyceremonyordinaryessentiallylatelyminorityprioritypraybuddydelaymarryrugbypoetrysillyequallypotentiallyoccasionallyjaythirtycommonlyefficiencyincrediblyincreasinglyhoneyscarylegacymerelysummarycurrencydaddyglorysalary