Skip to content

Word lists

Words With GH

1,515 words contain the letter pair GH, including right, through, high, might. Most common first.

Highest scoring

  • prizefightings33
  • highjacking32
  • prizefighting32
  • straightjackets32
  • highjacked31
  • prizefighters31
  • straightjacket31
  • prizefighter30

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first1,515

Showing the 400 most common of 1,515 words. The length links below give complete lists.

rightthroughhighmightnightthoughtenoughthoughlightalthoughfightrightshigherbroughtdaughterstraighttonighteightweightthroughoutfightingboughtcaughthighlyflighthighesttoughslightlythoughtstaughtlaughlightsbrightlaughingtightsightheightneighborhoodroughfoughtsoughthighwaynightsghostalrightroughlyoughtfightermidnightlightingknightdaughtershighlightslaughedcopyrightneighborsughslightlightningflightsfightershighlighteighthwrightfightsinsightnightmareovernightheightsneighbormightylaughterlighterdelightedthoroughlylaughsknightsshanghaiweighfreightdelightthoroughlightlysighcoughneighborhoodsdroughtspotlighthighlightedghostshighwaysneighboursneighboringdoughweightsinsightssunlightsightsdaylightweighingslaughterafghanboroughnaughtyoutrightoversightthoughtfulbreakthroughstraightforwardtwilightweighedeighteenrighteouslightweightslightestdelightfulneighbouringtightlyeightyuprightfrightenedoverweightthighrightlybrighternightmaresalmightyhighlandghettoweighsneighbourweightedthighsfrighteninghighlightingenlightenmenttougherhighlandsnightclubspaghettifirefightersheavyweighttoughestmoonlightgranddaughterhighstighterbrightnessbrightestlighthousesightedslaughteredtightenenlightenednightlyeighteenthrighteousnessheightenedplightcoughingflashlightwroughtbrightlytroughstrongholdfortnightinsightfulplaywrightsighsrightfuldownrightmanslaughterfirefighterlightenhighnesshindsightheadlightsdelightstoughnessfrightsightingtighteningtightstightenednightingaleeyesightsightingsoutweighnighttimestraightenbrightennighblightrightfullywightboroughseightiesenlightenonslaughtcopyrightedlaughablethroughputdoughnutlightedforesightdoughnutsnightlifedistraughtghostlystarlightsightseeingsighedstraightenedfraughtlimelightnightfallnightclubsploughhighlandersenlighteningdraughtfrightenghastlysloughfreighterbreakthroughsweightliftinglighteningwainwrightmiddleweightslaughteringcoughsbirthrightyoghurtcandlelightalightsleighdroughtsweightingcopyrightsthoroughbredheadlightlightnessthoughtfullynaughtafghanstightnessairtightlightestghiaghaghatgheeghispughsughughsvughyoghaarghaghasaughtbightboughbrughburghdightfaughghastghatsghautghazigheesghoulghyllgighehaughheighheughhightlaighloughneighnighsoghamsanghsaughsoughsughsteughvughswaughyoghsaarrghaghastarightaughtsaweighbightsboughsbrughsburghschoughcloughcuraghdightsdinghydoughsdoughtdoughydreighdriegheightsgharrigharryghautsghazisgheraoghiblighostyghoulsghyllshaughsheughshighthhightskiaughlaighsloughsmightsneighsnighednighernightynoughtoghamsoughtsquaighrightorightyroughssanghssaughssaughyshaughsheughsigherskeighsorghosoughssughedtoughstoughywaughtwightsaarrghhaboughtafghanialightsataghanbedightbigheadbighornbightedblightsblightyboughedbrightsburghalburgherchoughsclaughtcloughscoughedcoughercuraghscurraghdighteddoughtyeggheadeighthseightvoenoughsflightyfoghornfrightsgharialgharrisghaziesgherkinghettosghiblisghillieghostedghoulieginghamhaughtyheighthhighboyhighted